| Protein: 328777746 XP_396692.3 PREDICTED: ras-related protein Rap-1b |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.6 | 26.8 | 33.6 | 1.1785715 | 0.79761904 |
| Scape | 34.8 | 41.6 | 23.7 | 1.4683545 | 1.7552743 |
| Brain | 35.9 | 64.1 | 0.5600624 | ||
| Crop | 47.7 | 23.7 | 28.6 | 1.6678321 | 0.82867134 |
| Eye | 39.6 | 60.4 | 0.65562916 | ||
| Intestine | 39.1 | 22.7 | 38.2 | 1.0235602 | 0.59424084 |
| Leg, front | 37.7 | 30.9 | 31.3 | 1.2044729 | 0.98722047 |
| Leg, middle | 31 | 41.4 | 27.6 | 1.1231884 | 1.5 |
| Leg, rear | 37.3 | 30.5 | 32.2 | 1.158385 | 0.94720495 |
| Mandibular gland | 12.3 | 59.8 | 27.9 | 0.4408602 | 2.1433692 |
| Rectum | |||||
| Salivary gland, cerebral | 70.9 | 29.1 | 2.4364262 | ||
| Salivary gland, thoracic | 46.7 | 20.5 | 32.8 | 1.4237804 | 0.625 |
| Sternite | 15.6 | 55.2 | 29.2 | 0.53424656 | 1.8904109 |
| Tergite | |||||
| Ventriculus | 18.4 | 81.6 | 0.2254902 | ||
| Thoracic muscle | |||||
| Fat body | 42.6 | 26.3 | 31.2 | 1.3653846 | 0.84294873 |
| Malpighian tubules | 18.9 | 46.9 | 34.2 | 0.55263156 | 1.371345 |
| Nerve chord | 20.9 | 55.8 | 23.3 | 0.8969957 | 2.3948498 |
| Poison sac | |||||
| Sting | 10.2 | 89.8 | 0.11358575 | ||
| Heart | 22.2 | 49.8 | 28 | 0.79285717 | 1.7785715 |
| Hypopharyngeal gland | 38.5 | 61.5 | 0.62601626 | ||
| Galea | 40.8 | 27.3 | 32 | 1.275 | 0.853125 |
| Glossa | 47.9 | 28.2 | 23.9 | 2.004184 | 1.1799163 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.8 | 36.2 | 39.3 | 0.8600509 | 0.9211196 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MREYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG TEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDL EDERVVGKDQGVNLARQFNCAFMETSAKAKINVNDIFYDLVRQINKKSPEKKMKQKKKSL CLLL |
 Top
| |