| Protein: 328790677 XP_001121517.2 PREDICTED: vacuolar protein sorting-associated protein 29-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.5 | 45.5 | 1.1978022 | ||
| Scape | 47.8 | 52.2 | 0.91570884 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 43.2 | 56.8 | 0.7605634 | ||
| Leg, middle | 51 | 49 | 1.0408163 | ||
| Leg, rear | 60.9 | 39.1 | 1.5575447 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 36.8 | 27 | 36.2 | 1.0165746 | 0.74585634 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 67.6 | 32.4 | 2.0864198 | ||
| Malpighian tubules | 38.2 | 32.9 | 28.9 | 1.3217993 | 1.1384083 |
| Nerve chord | 34.9 | 24.7 | 40.4 | 0.8638614 | 0.6113861 |
| Poison sac | |||||
| Sting | |||||
| Heart | 28.3 | 43.5 | 28.2 | 1.0035461 | 1.5425532 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44 | 39.8 | 40.9 | 1.0757946 | 0.97310513 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNLIVNKCDKVNINVKKNKNFINIYYYIRHVLGDLHIPHRCSSLPSKFKKLLVPGRIQHI LCTGNLCTKESYDYLKTLASDVHVVRGDFDENLNYPEQKVVTVGQFRIGLSHGHQVVPWG DPESLALIQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAYNPLDTSVIPFFCSYG YSKFDSCNLCLSTCW |
 Top
| |