| Protein: 110777801 XP_001120025.1 PREDICTED: ras-related protein Rab-7a-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.9 | 29 | 33.2 | 1.1415663 | 0.87349397 |
| Scape | 38.5 | 21.6 | 39.9 | 0.9649123 | 0.5413534 |
| Brain | 51.5 | 48.5 | 1.0618557 | ||
| Crop | 47.7 | 23.9 | 28.4 | 1.6795775 | 0.8415493 |
| Eye | |||||
| Intestine | 29.8 | 34.4 | 35.9 | 0.83008355 | 0.95821726 |
| Leg, front | 36.3 | 33.2 | 30.6 | 1.1862745 | 1.0849674 |
| Leg, middle | 34.9 | 33.4 | 31.7 | 1.1009464 | 1.0536277 |
| Leg, rear | 40.3 | 27.9 | 31.8 | 1.2672956 | 0.8773585 |
| Mandibular gland | 3 | 75.6 | 21.4 | 0.14018692 | 3.5327103 |
| Rectum | 9.5 | 44.3 | 46.2 | 0.20562771 | 0.95887446 |
| Salivary gland, cerebral | 34.7 | 51.5* | 13.8 | 2.5144928 | 3.731884 |
| Salivary gland, thoracic | 46.9 | 16.8 | 36.3 | 1.292011 | 0.46280992 |
| Sternite | 17.9 | 38.5 | 43.7 | 0.409611 | 0.88100684 |
| Tergite | |||||
| Ventriculus | 20 | 80 | 0.25 | ||
| Thoracic muscle | |||||
| Fat body | 28.4 | 31.1 | 40.5 | 0.7012346 | 0.76790124 |
| Malpighian tubules | 27.3 | 40.3 | 32.4 | 0.8425926 | 1.2438271 |
| Nerve chord | 29.9 | 41.8 | 28.3 | 1.0565372 | 1.4770318 |
| Poison sac | |||||
| Sting | 42.8 | 57.2 | 0.74825174 | ||
| Heart | 26 | 40.3 | 33.7 | 0.77151334 | 1.1958457 |
| Hypopharyngeal gland | 55.4 | 44.6 | 1.2421525 | ||
| Galea | 37.8 | 24.2 | 37.9 | 0.9973615 | 0.63852245 |
| Glossa | 39.1 | 23.2 | 37.6 | 1.0398936 | 0.61702126 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.4 | 36.4 | 37.9 | 0.82849604 | 0.96042216 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASHKKILLKVIILGDSGVGKTSLMNQYVSKKFSNQYKATIGADFLTKEVMVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPSSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLETKVIHGKKAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRNNGKSDSCAC |
 Top
| |