| Protein: 328788782 XP_003251182.1 PREDICTED: 60S ribosomal protein L17 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 43.1 | 23.5 | 33.4 | 1.2904192 | 0.70359284 |
| Brain | |||||
| Crop | 51 | 49 | 1.0408163 | ||
| Eye | |||||
| Intestine | 54.7 | 45.3 | 1.2075055 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 81 | 0.8 | 18.2 | 4.4505496 | 0.043956045 |
| Salivary gland, thoracic | 34.5 | 30.5 | 35 | 0.98571426 | 0.87142855 |
| Sternite | 51.5* | 44.3* | 4.2 | 12.261905 | 10.547619 |
| Tergite | 5.1 | 94.3* | 0.6 | 8.5 | 157.16667 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 34.6 | 27.6 | 37.8 | 0.91534394 | 0.73015875 |
| Malpighian tubules | 35.1 | 26.9 | 38.1 | 0.9212598 | 0.70603675 |
| Nerve chord | 46.4 | 15.2 | 38.4 | 1.2083334 | 0.39583334 |
| Poison sac | |||||
| Sting | 53.4 | 46.6 | 1.1459228 | ||
| Heart | 16.9 | 51.3 | 31.9 | 0.52978057 | 1.6081505 |
| Hypopharyngeal gland | 23.9 | 76.1 | 0.31406045 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.7 | 38.3 | 35 | 1.1057143 | 1.0942857 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGRYSHEPVNASKSCKARGSNLRVHFKNTHETARAIKNMSLRRAQKYLKNVIEHKECVPF RRFNGGVGRCAQAKQFGTTQGRWPKKSAEFLLQLLKNAESNADVDGLDLDRLVINHIQVN HAPCLRRRTYRAHGRINPYMSSPCHIEVILTEKEDFVVKSPEEEPSKKKLSKKKLARQKE KMMRE |
 Top
| |