![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 300807169 NP_001180219.1 fatty acyl-CoA reductase 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 30 | 54.8* | 15.1 | 1.986755 | 3.6291392 |
| Eye | |||||
| Intestine | 49 | 51 | 0.9607843 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 17.5 | 52.2 | 30.2 | 0.5794702 | 1.7284768 |
| Salivary gland, cerebral | 21.1 | 42.9 | 36 | 0.5861111 | 1.1916667 |
| Salivary gland, thoracic | 48 | 14.6 | 37.3 | 1.2868633 | 0.3914209 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 13.9 | 86.1 | 0.16144018 | ||
| Heart | |||||
| Hypopharyngeal gland | 92.6 | 7.4 | 12.513514 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.2 | 45.7 | 37.6 | 0.7765958 | 1.2154255 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTISDNQCTSVRDFYKDRSIFITGGTGFMGKVLVEKLLRSCPGIKNIYILMRPKKSQDI QQRLQKLLDVPLFDKLRRDTPDELLKIIPIAGDVTEHELGISEADQNVIIRDVSIVFHSA ATVKFDEPLKRSVHINMIGTKQLLNLCHRMHNLEALIHVSTAYCNCDRYDVAEEIYPVSA EPEEIMALTKLMDSQMIDNITPTLIGNRPNTYTFTKALTERMLQSECGHLPIAIVRPSIV LSSFREPVSGWVDNLNGPTGIVAAAGKGFFRSMLCQKNMVADLVPVDIVINLMICTAWRT ATNRTKTIPIYHCCTGQQNPITWQQFVELILKYNRMHPPNDTIWWPDGKCHTFAIVNNVC KLFQHLLPAHILDFIFRLRGKPAIMVGLHEKIDKAVKCLEYFTMQQWNFRDDNVRQLSGE LSPEDRQIFMFDVKQIDWPSYLEQYILGIRQFIIKDSPETLPAARSHIKKLYWIQKVVEF GMLLVVLRFLLLRIPMAQSACFTLLSAILRMCRMIV |
|
| |