![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328789222 XP_392142.2 PREDICTED: nucleobindin-2-like partial |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 59.2 | 40.8 | 1.4509804 | ||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 52.5 | 47.5 | 1.1052631 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 91.3 | 8.7 | 10.494253 | ||
| Salivary gland, thoracic | 26.1 | 30.3 | 43.7 | 0.597254 | 0.69336385 |
| Sternite | 69.8 | 30.2 | 2.3112583 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 21.8 | 51.9 | 26.3 | 0.82889736 | 1.973384 |
| Malpighian tubules | 35.4 | 41.9 | 22.8 | 1.5526316 | 1.8377193 |
| Nerve chord | |||||
| Poison sac | 19.5 | 80.5 | 0.24223602 | ||
| Sting | |||||
| Heart | 22.6 | 47.9 | 29.5 | 0.7661017 | 1.6237289 |
| Hypopharyngeal gland | 31.3 | 68.7 | 0.45560408 | ||
| Galea | 36 | 64 | 0.5625 | ||
| Glossa | 26.5 | 73.5 | 0.3605442 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.8 | 41.3 | 44.7 | 0.935123 | 0.9239374 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
VTIHWSIAPPVNQKKDKDHDKNDEVEDVEEVVDMEYRRYLMEVVQALESDPEFQAKLENA LDSDIRTGKIAEELQFVNRNVRTRLDEIKREELERLRHLATKENELKNGLDVDHLKIPEH LDHTNTRTFEIQDLKKLIAKTTKDLAKADRKRREEFKRHEMEKQYKEKEKLKQMNDAEKK KYEEELQTMKEKQKKHEPVHHPGSKQQLEEVWEKQDHMENEEFNPRTFFFFHDVDGNGVW DQDEVKALFLKELDKLYAQGAPQDDFLKRAEEMERMREHVFNEADLNKDGLISYEEFLEQ TKKPDFQQDEGWLGLDEQQIYTQEEFEAFERHKQEEMQKMIAKGMLPPHPGSIPAQSEPF PSQYGHAPVAPGLIPPQVDSNQNILHQQQFQNPQYQQQPQIVNPQIHDQIQQQQQFQRQI PNQQYQYVQLPQEQNPVQQLHSAPIPNQQNQGQVLVQPHQSLGQQVQIPIQQNEHPNLQQ QQINQIPQNINVPQQNNQNQPNLQSTQIPTQQEINKVPTDQKV |
|
| |