Home List proteins by tissue Protein search Downloads Links
Protein: 328778017 XP_392616.3 PREDICTED: hypothetical protein LOC409090
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 43.4* 33.5 23.1 1.8787879 1.4502164
Scape 35.9 31.6 32.5 1.1046153 0.9723077
Brain 67.8 32.2 2.10559
Crop 20.1 59.3* 20.6 0.97572815 2.878641
Eye 77.7* 12.2 10.1 7.6930695 1.2079208
Intestine 15.9 30.9 53.3 0.29831144 0.57973737
Leg, front 27.2 34.1 38.7 0.70284235 0.88113695
Leg, middle 26.9 37.4 35.6 0.755618 1.0505618
Leg, rear 16.3 46.2 37.4 0.43582886 1.2352941
Mandibular gland 21.2 3.8 75 0.28266665 0.050666668
Rectum 13.9 55.1 31.1 0.44694534 1.7717042
Salivary gland, cerebral 30.2 34 35.8 0.8435754 0.9497207
Salivary gland, thoracic 42.4 25.7 31.9 1.3291537 0.8056426
Sternite 28.9 34.2 36.9 0.7831978 0.9268293
Tergite 42.5 21.7 35.8 1.1871508 0.60614526
Ventriculus 48 52 0.9230769
Thoracic muscle 35.5 40.4 24.1 1.473029 1.6763486
Fat body 25.3 62.3* 12.4 2.0403225 5.024194
Malpighian tubules 36 26.2 37.9 0.9498681 0.6912929
Nerve chord 31 13.7 55.2 0.5615942 0.2481884
Poison sac
Sting 58 42 1.3809524
Heart 50.6 15.1 34.3 1.4752187 0.44023323
Hypopharyngeal gland 81.5 18.5 4.4054055
Galea 25.5 41.7 32.8 0.777439 1.2713414
Glossa 25.8 34.2 40 0.645 0.855
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 32 37.9 35.2 0.90909094 1.0767045
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MCSNSTTVLLKKRERTQNWIPEEKNVLFSLIKGHVNAIENKKIDAAASAMKMLAWQQIHR
TFRGMFSIDRDITRMREQWRRMKSQARMEMYTFAEKMKTLGPEEAAKCRPSDLSIEVWKL
MEKTRKNDGDKDRSDENGRRSPENLTSLQAILNKLTATTPEVTTVNEIKVDADSDEYNTE
EDSSQSEILKEKPGVSQKKRLRISEEEPIDLPEQGFNSMDTMICDVEDGVSTSYMKERNS
RFNNEQDESIQGRMWMFEMAQREHELKLRMLNIALEKVELQKQTAINELKTSEIKRQLVE
NQAAEYYSQVRMVGERGSGAGKGGGGGGSIREAGGSFGKMEAAHEDQYFYNLQKQQLQKL
KEDLHDEISFHEEQIKRHQEAINRHKKRITEMDKK

Top