| Protein: 328784439 XP_003250452.1 PREDICTED: 5-formyltetrahydrofolate cyclo-ligase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23 | 77 | 0.2987013 | ||
| Scape | 61.3 | 38.7 | 1.5839794 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 54.2 | 45.8 | 1.1834061 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 88.7 | 11.3 | 7.8495574 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 17.2 | 40.7 | 42.1 | 0.40855107 | 0.96674585 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 3.2* | 35 | 61.7 | 0.051863857 | 0.5672609 |
| Malpighian tubules | 28.8 | 25.7 | 45.5 | 0.63296705 | 0.5648352 |
| Nerve chord | 63.3 | 36.7 | 1.7247957 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 4.9* | 32.6 | 62.5 | 0.0784 | 0.5216 |
| Hypopharyngeal gland | 61.4 | 38.6 | 1.5906736 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.4 | 42.8 | 46 | 0.7695652 | 0.93043476 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTGIKSAKFALRKKMKNIIEQLSTEEKQRQSMEVFKKLCSLSQFQNSKRISLYLSTKDEI DTIPILKHIFEAKKEVFVPRYNGKEMEMVKLFSMEDYETLPLTKWNIKQPNYNENRENAL ETGGLDLILLPGLAFTINGKRLGHGMGYYDKFLELCLKKQQNKPHLIAVAFNEQLWEDIP TSENDIVLDLVLTEK |
 Top
| |