| Protein: 328786638 XP_624935.2 PREDICTED: arginase-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.2* | 93.3* | 6.5 | 0.03076923 | 14.353847 |
| Sternite | |||||
| Tergite | 61.6 | 38.4 | 1.6041666 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 1.1* | 50.5 | 48.5 | 0.022680411 | 1.0412371 |
| Malpighian tubules | |||||
| Nerve chord | 18 | 82 | 0.2195122 | ||
| Poison sac | |||||
| Sting | 67 | 33 | 2.030303 | ||
| Heart | 1.3* | 41.6 | 57.1 | 0.022767074 | 0.7285464 |
| Hypopharyngeal gland | |||||
| Galea | 55.8 | 44.2 | 1.2624434 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 0.8 | 55.4 | 44.3 | 0.018058691 | 1.2505643 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNSLRKIQSVIIRLGNRYYKKLGIIGVPFEKGQHKKGVAQGPEAIRKAGLMKELELLGLD VKDYGNILYKAKNVAEVDNMTHLGDVAGCTSKLSEQFQQILKKDRRILTLGGDHSLGIGT IDGHVKEKGDIALIWVDAHADLNTNKTSTTGLFHGMPVALLTSELADYWPHLPGMDWQKP MLSIRNVAYIGLREVDSYERLVIEKFGITAFGMEDIERYGIHDVTYMALSKIDPNDSRSI HVSFDIDSLDPLEAPCTGTPVRGGLSLREAIHLMEVLYRTKRLNALDIVEINPYIGNKYD VQLTIGAAIHIIQAGFGYSRRGLRVPEGVTDIPLPTVK |
 Top
| |