| Protein: 66519233 XP_395866.2 PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57 | 43 | 1.3255814 | ||
| Scape | 43.7 | 26.2 | 30.1 | 1.4518273 | 0.8704319 |
| Brain | 34.8 | 65.2 | 0.5337423 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 29.4 | 29.3 | 41.2 | 0.71359223 | 0.7111651 |
| Leg, front | 55.9 | 44.1 | 1.2675737 | ||
| Leg, middle | 20.8 | 38.9 | 40.2 | 0.51741296 | 0.9676617 |
| Leg, rear | 40.6 | 29.8 | 29.6 | 1.3716216 | 1.0067568 |
| Mandibular gland | 13.1 | 86.9 | 0.15074798 | ||
| Rectum | |||||
| Salivary gland, cerebral | 53.2 | 4.1 | 42.7 | 1.2459016 | 0.09601873 |
| Salivary gland, thoracic | 43.2 | 24.1 | 32.7 | 1.321101 | 0.737003 |
| Sternite | 38.3 | 61.7 | 0.62074554 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 7 | 80 | 13 | 0.53846157 | 6.1538463 |
| Fat body | 25.4 | 44.9 | 29.7 | 0.8552188 | 1.5117846 |
| Malpighian tubules | 29.1 | 35.1 | 35.8 | 0.81284916 | 0.98044693 |
| Nerve chord | 25.7 | 29.1 | 45.2 | 0.5685841 | 0.6438053 |
| Poison sac | |||||
| Sting | 29.6 | 70.4 | 0.42045453 | ||
| Heart | 22.3 | 25.5 | 52.2 | 0.42720306 | 0.48850575 |
| Hypopharyngeal gland | 69.2 | 30.8 | 2.2467532 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.3 | 35.9 | 44.1 | 0.75510204 | 0.81405896 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFQNFSICRASLIGISRSTRSKKKLPRDGSTICIYNVLLRSQLSQITNIQGLSIRFYSNP ARRPSFFSQFLENIKQEMQKNKEMKESLKKFREEAEKLEQSEALRSARQKFQAVESEATK GSEALKEKLESLKEKVQEVLEEASKTELGKKAGQLSEEISKSAKGAAETISEKSQALGKT SAFQTISQTVEAVREELDHQGMHGKVYVPPKKLRKRKDVIESVDSKVVQPNAEATGVELH KDSKFYQSWQNFKDKNPYVNKVLEWKIKYEESDNPVIRASRLLTEKVTDIVGGLFQKTDL SETLTEICKLDPNFDRIQFLKYCETDIIPNILEAMVRGNLEILKDWCHEAPYKLIAQPLI QVEKLGYQLDNKILDINNVDLIMGKVMEQGPVLIISFQCQQIMCVRDAKKNVIEGDPEKV MRVNYIWVLCRDPTELNPKAAWRLLDLSVTSTEQFV |
 Top
| |