| Protein: 110764063 XP_624943.2 PREDICTED: 40S ribosomal protein S7 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 31.8 | 41.3 | 26.9 | 1.1821561 | 1.535316 |
| Brain | |||||
| Crop | 26.2 | 36.3 | 37.5 | 0.6986667 | 0.968 |
| Eye | 61.4 | 38.6 | 1.5906736 | ||
| Intestine | 18.6 | 36.8 | 44.5 | 0.41797754 | 0.8269663 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 82.3 | 1.5 | 16.3 | 5.04908 | 0.09202454 |
| Salivary gland, thoracic | 38.9 | 17.7 | 43.4 | 0.89631337 | 0.4078341 |
| Sternite | 11.5 | 59.2 | 29.3 | 0.39249146 | 2.0204778 |
| Tergite | 55.2 | 37.5 | 7.3 | 7.5616436 | 5.1369863 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 34.7 | 38.1 | 27.3 | 1.2710623 | 1.3956044 |
| Malpighian tubules | 40.5 | 23.7 | 35.8 | 1.131285 | 0.66201115 |
| Nerve chord | 34.8 | 14.7 | 50.5 | 0.6891089 | 0.29108912 |
| Poison sac | |||||
| Sting | 43.2 | 56.8 | 0.7605634 | ||
| Heart | 22.3 | 36.2 | 41.5 | 0.5373494 | 0.8722892 |
| Hypopharyngeal gland | 16.6 | 83.4 | 0.19904077 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.1 | 33.2 | 38.5 | 0.93766236 | 0.86233765 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFPANAKIIKSGGAEPDAFEASISQALLELEMNSDLKSQLRELYITKAREIETNNKKCII IYVPMPKLKAFQKIQTRLVRELEKKFSGKHVMFVGERKILPKPTRKTRTKNKQKRPRSRT LTAVYDALLEDLVYPVEIVGKRIRIKLDGTQLIKVHLDKNEQTNIEHKVDTFAAVYKKLT GRDVTFEFPETYV |
 Top
| |