| Protein: 48126476 XP_396596.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 57.5 | 42.5 | 1.3529412 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.4 | 10.3 | 45.3 | 0.98013246 | 0.22737306 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.7 | 41.2 | 27.1 | 1.1697417 | 1.5202953 |
| Malpighian tubules | 24.5 | 40.8 | 34.7 | 0.7060519 | 1.1757925 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 9.3 | 44 | 46.7 | 0.19914347 | 0.94218415 |
| Hypopharyngeal gland | 22.9 | 77.1 | 0.29701686 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.5 | 36.1 | 45.6 | 0.6030702 | 0.7916667 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALNLTVKVHPVVLFQIVDAYERRKAESHRVIGTLLGTAEKGMVEVTNCFCVPHKESESQ VEADLTYGIDLYELNHRVNAQENIVGWWATGNEVTTHSSVIHEYYVRECNNPVHLTVDTT LANTTRMGIKAYVCVPLGVPNGKQGSMFTPVKVQITCYEPEIVGLQLCSKTQLPAHAQIT GVKTGGGIEPMMDLSQIAEASAKLSSMLEQVLAYVDDVLTGKQPPDNQVGRALLDMVHSV PKMSSDQFDEMFNSNVKDLLMVVALSQLIKTQLQLNEKLTLLTTL |
 Top
| |