| Protein: 328789473 XP_625125.2 PREDICTED: glucosidase 2 subunit beta-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.9 | 25.6 | 28.5 | 1.6105263 | 0.89824563 |
| Scape | 29 | 48.7 | 22.2 | 1.3063064 | 2.1936936 |
| Brain | 48.6 | 51.4 | 0.9455253 | ||
| Crop | 30.8 | 27.2 | 42 | 0.73333335 | 0.64761907 |
| Eye | 62.2 | 15.5 | 22.3 | 2.7892377 | 0.6950673 |
| Intestine | 19.3 | 59.6* | 21.1 | 0.9146919 | 2.8246446 |
| Leg, front | 60.2 | 39.8 | 1.5125629 | ||
| Leg, middle | 33 | 40.5 | 26.5 | 1.245283 | 1.5283018 |
| Leg, rear | 69.8 | 30.2 | 2.3112583 | ||
| Mandibular gland | |||||
| Rectum | 3.8 | 78.9 | 17.4 | 0.21839081 | 4.534483 |
| Salivary gland, cerebral | 84.8 | 6.2 | 9 | 9.422222 | 0.6888889 |
| Salivary gland, thoracic | 49.6 | 16.7 | 33.7 | 1.4718101 | 0.49554896 |
| Sternite | 12 | 60.3 | 27.8 | 0.43165466 | 2.1690648 |
| Tergite | 76.2 | 23.8 | 3.2016807 | ||
| Ventriculus | 10.3 | 53.4 | 36.2 | 0.2845304 | 1.4751381 |
| Thoracic muscle | |||||
| Fat body | 38.1 | 26.9 | 35 | 1.0885714 | 0.76857144 |
| Malpighian tubules | 23.8 | 35.3 | 40.9 | 0.5819071 | 0.8630807 |
| Nerve chord | 36.1 | 30.1 | 33.8 | 1.0680473 | 0.89053255 |
| Poison sac | 11.4 | 88.6 | 0.12866817 | ||
| Sting | |||||
| Heart | 21.6 | 45.4 | 33 | 0.6545454 | 1.3757576 |
| Hypopharyngeal gland | 37.5 | 62.5 | 0.6 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.6 | 40.2 | 34.6 | 1.0289017 | 1.1618497 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNSCGIYLIFFLSVNLLIPLGHVAGSKVLQIRGIPIAKSSLYSSDRDFQCLDGSLLIPFS RVNDNYCDCADGSDEPGTSACTNGSFYCENSGHKPRYIPSTWVNDGVCDCCDASDEYNSS KECPNNCNELGKEARLEQQKAEELIREGNKIRMEMIAKGKQLKTDYQAQLVKLRADYEEA ERVKKEKELLKTQAEERESAALEKYKTIESEQPAQEEGEEEEELHESDAEDYFKLLDSDN SGTITVAELQTRVTFDKDRNGVVSEEEAMFFLNNQKEINLQEFMDTAWANIKPFLMLEQG MFKPAEQKEEEGEEEEEGGENIHEPIEDRSEQEKVENDGTEAEEVTDEEQKKTEEPQVQY DEETQALIDEATVARENFQAAERSVNDLLLEIRKYEEKLNRDFGVEHEFAPLDGECFEFR NVEYIYTLCMFVKATQRSESGGNDVTLGHWNDWSGPEGQKYFKMKYDRGLSCWNGPARST MVNLSCGKENKLVSVTEPSRCEYAMEFSTPAVCNLSLEPANAHDEL |
 Top
| |