| Protein: 110763671 XP_623194.2 PREDICTED: phosphatidylethanolamine-binding protein homolog F40A3.3-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.9 | 41.9 | 27.1 | 1.1402214 | 1.5461254 |
| Scape | 21.5 | 47.8 | 30.7 | 0.7003257 | 1.5570033 |
| Brain | 37.8 | 32.7 | 29.5 | 1.281356 | 1.1084746 |
| Crop | 28.9 | 28.5 | 42.6 | 0.67840374 | 0.6690141 |
| Eye | 48.4 | 37.9 | 13.7 | 3.5328467 | 2.7664235 |
| Intestine | 40.9 | 27 | 32.1 | 1.2741433 | 0.8411215 |
| Leg, front | 31 | 44 | 25.1 | 1.2350597 | 1.7529881 |
| Leg, middle | 28.8 | 44 | 27.1 | 1.0627307 | 1.6236162 |
| Leg, rear | 37.3 | 38.5 | 24.2 | 1.5413224 | 1.5909091 |
| Mandibular gland | 4 | 81.5 | 14.5 | 0.27586207 | 5.62069 |
| Rectum | 32.9 | 26.2 | 40.9 | 0.804401 | 0.6405868 |
| Salivary gland, cerebral | 74.5 | 14.9 | 10.7 | 6.962617 | 1.3925234 |
| Salivary gland, thoracic | 28.2 | 36.1 | 35.8 | 0.7877095 | 1.0083799 |
| Sternite | 25.4 | 42.1 | 32.5 | 0.7815385 | 1.2953846 |
| Tergite | 11.7 | 47 | 41.3 | 0.28329298 | 1.1380146 |
| Ventriculus | 49.4 | 50.6 | 0.97628456 | ||
| Thoracic muscle | 19.5 | 45.9 | 34.6 | 0.5635838 | 1.3265896 |
| Fat body | 39.8 | 17.6 | 42.6 | 0.9342723 | 0.41314554 |
| Malpighian tubules | 29.2 | 27.5 | 43.3 | 0.6743649 | 0.63510394 |
| Nerve chord | 29 | 39.8 | 31.1 | 0.93247586 | 1.2797427 |
| Poison sac | 7.7 | 92.3 | 0.08342362 | ||
| Sting | 55.6 | 44.4 | 1.2522522 | ||
| Heart | 24.8 | 34.1 | 41.1 | 0.6034063 | 0.8296837 |
| Hypopharyngeal gland | 64.8 | 35.2 | 1.8409091 | ||
| Galea | 36.2 | 30.1 | 33.7 | 1.074184 | 0.89317507 |
| Glossa | 22.3 | 47.7 | 30 | 0.74333334 | 1.59 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31 | 38.9 | 34.9 | 0.88825214 | 1.1146132 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLLFINTTSLFVRKPLLEIGIRLLSSMAQALQTHGVVPDVIDKVPENVLKVTYPNQISV DIGKVLTPTQVKDKPNVTWNGDANTYYTLCMTDPDAPSRKNPKFREWHHWLIGNIPGSEI AKGDVLSDYIGSGPPKDTGLHRYVFLLYKQPGKLTFDERRLTNRSGQNRGNFSIRKFATK YKLGDPIAANMYQAEFDDYVPLLYKQLEG |
 Top
| |