| Protein: 240255421 NP_001155303.1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57 | 43 | 1.3255814 | ||
| Scape | 44.3 | 18.1 | 37.6 | 1.1781915 | 0.48138297 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 38.5 | 32.3 | 29.2 | 1.3184931 | 1.1061643 |
| Salivary gland, thoracic | 23.2 | 49.2 | 27.6 | 0.8405797 | 1.7826087 |
| Sternite | 34.5 | 24.5 | 41 | 0.8414634 | 0.597561 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 55.3 | 44.7 | 1.2371365 | ||
| Fat body | |||||
| Malpighian tubules | 13.8 | 56.4 | 29.8 | 0.46308726 | 1.8926175 |
| Nerve chord | 60.8* | 15.8 | 23.5 | 2.587234 | 0.67234045 |
| Poison sac | |||||
| Sting | 54.3 | 45.7 | 1.1881838 | ||
| Heart | 53.4 | 21.7 | 24.9 | 2.1445782 | 0.87148595 |
| Hypopharyngeal gland | 92* | 8 | 11.5 | ||
| Galea | 40.1 | 26.3 | 33.6 | 1.1934524 | 0.7827381 |
| Glossa | 40 | 21.2 | 38.8 | 1.0309278 | 0.5463917 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.4 | 39.1 | 32.9 | 1.2279636 | 1.1884499 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDNKPPKYHTFMEPLFTSPITDYFGISLHAQCYSACKDFELRLAECVEAYGFFKGQEKCE PLILDLDECLYKEKRKHRQEIISGEFQRQIDAGERKHEKAPFLFFF |
 Top
| |