| Protein: 66534766 XP_624987.1 PREDICTED: cytochrome c oxidase subunit 5B mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.8 | 28.9 | 31.3 | 1.2715654 | 0.9233227 |
| Scape | 47.1 | 17.1 | 35.8 | 1.3156425 | 0.47765362 |
| Brain | 57.7 | 21.1 | 21.2 | 2.721698 | 0.995283 |
| Crop | 24.6 | 42.7 | 32.7 | 0.7522936 | 1.3058105 |
| Eye | 47.1 | 22.3 | 30.6 | 1.5392157 | 0.72875816 |
| Intestine | 29.1 | 35.5 | 35.3 | 0.82436264 | 1.0056658 |
| Leg, front | 8* | 41 | 50.9 | 0.15717092 | 0.805501 |
| Leg, middle | 41.2 | 28.2 | 30.7 | 1.3420196 | 0.91856676 |
| Leg, rear | 25.5 | 21.5 | 53 | 0.48113206 | 0.4056604 |
| Mandibular gland | 67.8 | 4.9 | 27.3 | 2.4835165 | 0.17948718 |
| Rectum | 39.5 | 16.7 | 43.9 | 0.8997722 | 0.38041002 |
| Salivary gland, cerebral | 33.4 | 35 | 31.5 | 1.0603175 | 1.1111112 |
| Salivary gland, thoracic | 21.6 | 52.2 | 26.2 | 0.8244275 | 1.9923664 |
| Sternite | 31.2 | 30.1 | 38.7 | 0.8062016 | 0.7777778 |
| Tergite | 33.2 | 30.8 | 36 | 0.9222222 | 0.85555553 |
| Ventriculus | 27.1 | 72.9 | 0.3717421 | ||
| Thoracic muscle | 16 | 67.9 | 16.1 | 0.99378884 | 4.2173915 |
| Fat body | 29.8 | 50.6 | 19.5 | 1.5282052 | 2.5948718 |
| Malpighian tubules | 39.1 | 23.1 | 37.9 | 1.0316622 | 0.6094987 |
| Nerve chord | 50.3 | 8.4 | 41.3 | 1.2179177 | 0.20338984 |
| Poison sac | |||||
| Sting | 24.4 | 75.6 | 0.3227513 | ||
| Heart | 53.3 | 14.4 | 32.2 | 1.6552795 | 0.44720498 |
| Hypopharyngeal gland | 85.2 | 14.8 | 5.756757 | ||
| Galea | 53.2 | 22.9 | 23.8 | 2.235294 | 0.96218485 |
| Glossa | 54.9 | 15.6 | 29.5 | 1.861017 | 0.52881354 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.3 | 30.7 | 35.6 | 1.0758427 | 0.8623595 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAWLCSRIVFHKCRRTFSCNAVKFSKKETFPDPLELATGLEKRELLAAAAGNFDPYHMKA IEISRDSTKDCPNLVPSAFKSRIVGCICEPDTSHVNWMWLHDGQPRRCECGHWFKLTQVA PL |
 Top
| |