| Protein: 328790489 XP_624339.2 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 30.4 | 38.1 | 31.6 | 0.96202534 | 1.2056962 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 55 | 45 | 1.2222222 | ||
| Leg, middle | 52.3 | 47.7 | 1.096436 | ||
| Leg, rear | 58.3 | 41.7 | 1.3980815 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 35.9 | 64.1 | 0.5600624 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 36.6 | 19.6 | 43.8 | 0.8356164 | 0.44748858 |
| Nerve chord | 21.5 | 43.9 | 34.6 | 0.6213873 | 1.2687861 |
| Poison sac | |||||
| Sting | |||||
| Heart | 29.7 | 33.9 | 36.4 | 0.81593406 | 0.9313187 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.5 | 34.3 | 43.1 | 0.93967515 | 0.7958237 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSEQSIYDMAYRGKTTDVKNLLNENEKLKIAKDNNGRMLIHWAALGGHDDLVRYLLSLDV PVDPTDDTDMTPLILAASAGREKVVNTLLIEGAYVNAKTQEGHSALQYAASKNWKSICAA LLEKDANVNITDNRGATPLHRAASKGNIAIVKLLIEYGRNLDIDSKDADGNSALHLACEE NRVDEAKLLVQNGASTTLKNKQKKTPLDLATPRLVQQLKEIEEDSS |
 Top
| |