| Protein: 66524293 XP_393965.2 PREDICTED: 40S ribosomal protein SA |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.1 | 57.9 | 0.7271157 | ||
| Scape | 41.2 | 35.8 | 23.1 | 1.7835498 | 1.5497836 |
| Brain | |||||
| Crop | 16.6 | 43.6 | 39.8 | 0.41708544 | 1.0954773 |
| Eye | 21.9 | 42.7 | 35.4 | 0.61864406 | 1.2062147 |
| Intestine | 60.3 | 39.7 | 1.5188917 | ||
| Leg, front | 33.1 | 33.2 | 33.7 | 0.98219585 | 0.9851632 |
| Leg, middle | |||||
| Leg, rear | 51.6 | 21.9 | 26.5 | 1.9471698 | 0.8264151 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 83.8 | 8.5 | 7.7 | 10.883117 | 1.1038961 |
| Salivary gland, thoracic | 36.3 | 27.2 | 36.5 | 0.99452055 | 0.74520546 |
| Sternite | 38 | 51.3 | 10.6 | 3.5849056 | 4.8396225 |
| Tergite | 23.9 | 60.3 | 15.9 | 1.5031446 | 3.7924528 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.4 | 39.3 | 29.2 | 1.0753424 | 1.3458904 |
| Malpighian tubules | 33.7 | 29.2 | 37.1 | 0.9083558 | 0.787062 |
| Nerve chord | 44.5 | 25.8 | 29.8 | 1.4932886 | 0.86577183 |
| Poison sac | 91.4* | 8.6 | 10.627907 | ||
| Sting | 47.4 | 52.6 | 0.9011407 | ||
| Heart | 19.4 | 50.1 | 30.5 | 0.6360656 | 1.642623 |
| Hypopharyngeal gland | 21.1 | 78.9 | 0.26742712 | ||
| Galea | 38.1 | 21.3 | 40.6 | 0.93842363 | 0.52463055 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.7 | 39.6 | 33.4 | 1.0988024 | 1.1856288 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSGGLDVLSLKEDDVTKMLAAYTHLGAENVNFQMEQYVYKKKSDGVSIINLRHTWEKLLL AARAIVAIEHPSEVFVISCRQTGQRAVLKFAQHTGATPIAGRFTPGAFTNQIQSAFREPR LLIVTDPSTDHQPITEASYVNIPVIAFCNTDSPLRFVDIAIPCNTKSLHCVGLMWWLLAR EVLRLRGSIARETKWDVVVDLFFYRDPEEAEKEEQAAKEIAPAKDFAGAVEVAAAAEPGW VNEVDTAGAVAPENWADDVATPTAATIPTAGAAQAFQTSGDWAAQTSEEWSATTQSAAGQ SWGGATTEKW |
 Top
| |