| Protein: 48098081 XP_393969.1 PREDICTED: cytochrome P450 9e2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23.9 | 37.8 | 38.3 | 0.6240209 | 0.98694515 |
| Scape | 31.3 | 24.2 | 44.6 | 0.70179373 | 0.54260087 |
| Brain | 8.2* | 18.3 | 73.5 | 0.11156463 | 0.2489796 |
| Crop | 49.7 | 7.8 | 42.5 | 1.1694118 | 0.1835294 |
| Eye | 12.3* | 87.7 | 0.14025086 | ||
| Intestine | 26.5 | 44 | 29.5 | 0.89830506 | 1.4915254 |
| Leg, front | 25.2 | 28.1 | 46.7 | 0.53961456 | 0.60171306 |
| Leg, middle | 27.6 | 28.3 | 44.1 | 0.6258503 | 0.64172333 |
| Leg, rear | 31 | 23.3 | 45.7 | 0.678337 | 0.5098468 |
| Mandibular gland | 55.5 | 44.5 | 1.247191 | ||
| Rectum | 36.6 | 45.5 | 17.8 | 2.0561798 | 2.5561798 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 61.8 | 11.1 | 27.1 | 2.2804427 | 0.4095941 |
| Sternite | 23.5 | 24.6 | 51.9 | 0.45279384 | 0.47398844 |
| Tergite | 33 | 67 | 0.49253732 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 43.2 | 11.2 | 45.6 | 0.94736844 | 0.24561404 |
| Malpighian tubules | 14.9 | 67.5* | 17.5 | 0.85142857 | 3.857143 |
| Nerve chord | 13 | 59.3 | 27.6 | 0.4710145 | 2.1485507 |
| Poison sac | |||||
| Sting | |||||
| Heart | 6.4 | 41.4 | 52.2 | 0.12260536 | 0.79310346 |
| Hypopharyngeal gland | 83.1 | 16.9 | 4.9171596 | ||
| Galea | 48.1 | 25.1 | 26.8 | 1.7947761 | 0.9365672 |
| Glossa | 71.9 | 28.1 | 2.558719 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 32.9 | 41.7 | 0.7961631 | 0.7889688 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLDSWSITAAIVAVLAIAYYQLIWKYKHFERIGIPCYHSIPLLGSFWEAVIQRNNFAEIS RKIYNSYPDTKYMGMYDTTTPVLLIRDTELIKAISVKHFEQFPDHRSFQNEATDPLFAKN LFALRGDRWREIRNLLSPAFTSSKMKSMFILMRDCAKEYGDYFASLTGDESTIELKDAFT RYTNDVIATCAFGVEVNSMKDRKNKFYVYGREGTTFGSWASIKFFVTRVLPVSVCTLLRI RLIRKEISDFFIDLVSTTIKTREEKGIVRPDMIQLMMESKGKLGAGKEMSMIDICAQAFV FFFGGFESTSTLMCFAAYEIAVNEDIQRRLQNEIDQVLEERDGEVTYAAVNEMKFLDAII YEALRMYPVVVATDRVCMKPFELPPNRPGEKPYLLKEGDNVWFPIYAIQRDPQYYPEPDK FDPDRFLNDTKQMINSGLFLTFGIGPRMCIGNRFAMLETKVLLFHLFARCNLVPCSKTTI PMKLNRKGFSMTAENGFWFKIEPRSAKKEEKIAVPGTTMLIDKIPDRYPDN |
 Top
| |