| Protein: 328792687 XP_001122909.2 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 49.9 | 21.4 | 28.6 | 1.7447553 | 0.74825174 |
| Brain | |||||
| Crop | |||||
| Eye | 43.9 | 56.1 | 0.7825312 | ||
| Intestine | 56.2 | 43.8 | 1.283105 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 96.9* | 3.1 | 31.258064 | ||
| Rectum | |||||
| Salivary gland, cerebral | 14.8 | 49 | 36.3 | 0.4077135 | 1.3498622 |
| Salivary gland, thoracic | 28.1 | 40.3 | 31.6 | 0.8892405 | 1.2753165 |
| Sternite | 25.5 | 37 | 37.5 | 0.68 | 0.9866667 |
| Tergite | 15.6 | 84.4 | 0.18483412 | ||
| Ventriculus | |||||
| Thoracic muscle | 27.6 | 72.4 | 0.38121548 | ||
| Fat body | 51 | 33.4 | 15.6 | 3.2692308 | 2.1410255 |
| Malpighian tubules | 52.7 | 12.3 | 35 | 1.5057143 | 0.35142857 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 32.5 | 67.5 | 0.4814815 | ||
| Heart | 33.6 | 17.4 | 49 | 0.6857143 | 0.35510203 |
| Hypopharyngeal gland | |||||
| Galea | 35.1 | 32.6 | 32.4 | 1.0833334 | 1.0061729 |
| Glossa | 52.2 | 16.7 | 31.1 | 1.6784565 | 0.53697747 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.5 | 31.7 | 41.6 | 0.9735577 | 0.7620192 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAKYLGVDKIYNLWNIIRANGGILNSVYTLFRTDTLKAGTLVGKDKYGNKYYENNSLFYG KLMNK |
 Top
| |