| Protein: 328781627 XP_003250006.1 PREDICTED: FUN14 domain-containing protein 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.1 | 38.7 | 28.2 | 1.1737589 | 1.3723404 |
| Scape | 34.9 | 28.4 | 36.7 | 0.95095366 | 0.773842 |
| Brain | |||||
| Crop | 23.7 | 76.3 | 0.310616 | ||
| Eye | 56.7 | 43.3 | 1.3094689 | ||
| Intestine | 15.2 | 44.1 | 40.7 | 0.37346438 | 1.083538 |
| Leg, front | 24.2 | 43.6 | 32.2 | 0.7515528 | 1.3540373 |
| Leg, middle | 39.5 | 60.5 | 0.6528926 | ||
| Leg, rear | 51.1 | 48.9 | 1.0449898 | ||
| Mandibular gland | 10.8 | 89.2 | 0.12107623 | ||
| Rectum | 67.3 | 32.7 | 2.058104 | ||
| Salivary gland, cerebral | 66.3 | 0.9 | 32.8 | 2.0213416 | 0.027439024 |
| Salivary gland, thoracic | 31.2 | 37.2 | 31.6 | 0.98734176 | 1.1772152 |
| Sternite | 43 | 57 | 0.75438595 | ||
| Tergite | 56 | 44 | 1.2727273 | ||
| Ventriculus | |||||
| Thoracic muscle | 58.1 | 41.9 | 1.3866348 | ||
| Fat body | 47.8 | 29.5 | 22.6 | 2.1150444 | 1.3053098 |
| Malpighian tubules | 46.8 | 53.2 | 0.87969923 | ||
| Nerve chord | 21 | 41 | 38 | 0.55263156 | 1.0789474 |
| Poison sac | |||||
| Sting | 7.8* | 92.2 | 0.0845987 | ||
| Heart | 9.2 | 37.2 | 53.6 | 0.1716418 | 0.69402987 |
| Hypopharyngeal gland | 83.2 | 16.8 | 4.952381 | ||
| Galea | 39.5 | 24.3 | 36.2 | 1.0911602 | 0.6712707 |
| Glossa | 39.9 | 1.9* | 58.2 | 0.685567 | 0.03264605 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.9 | 36.6 | 46.4 | 0.7737069 | 0.7887931 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPKVYKNTIKSGTTKLFKRVKMSLPVTKKNKDNANKEELNISKHAESMIDKILGDVNKKS TTKQIIIGTTSGWLTGFITIKIGKITAFAVGGGIIMLQIAAHQGYIKINWDKIQKKAEKI TDKVEETVTGEGPKFLDKVERYVDKKLDKAEQLLKNGESRTRRWYHSITGDTSFKPTEFH FFLSYFVGGFALGIVSGKLI |
 Top
| |