| Protein: 328792246 XP_394167.4 PREDICTED: cat eye syndrome critical region protein 5-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.9 | 60.1 | 0.6638935 | ||
| Scape | 23.6 | 35.4 | 41 | 0.57560974 | 0.86341465 |
| Brain | 41.7 | 58.3 | 0.71526587 | ||
| Crop | 36.4 | 63.6 | 0.572327 | ||
| Eye | |||||
| Intestine | 25.3 | 20.1 | 54.6 | 0.46336997 | 0.36813188 |
| Leg, front | 34.5 | 24.2 | 41.3 | 0.8353511 | 0.5859564 |
| Leg, middle | 32 | 28 | 39.9 | 0.802005 | 0.7017544 |
| Leg, rear | 27.6 | 19.5 | 53 | 0.5207547 | 0.36792454 |
| Mandibular gland | |||||
| Rectum | 71.9 | 28.1 | 2.558719 | ||
| Salivary gland, cerebral | 13.2 | 86.8 | 0.15207373 | ||
| Salivary gland, thoracic | 31.5 | 37.9 | 30.7 | 1.0260587 | 1.2345277 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 5.3 | 65 | 29.7 | 0.17845118 | 2.1885521 |
| Fat body | 73.2 | 26.8 | 2.7313433 | ||
| Malpighian tubules | 29.2 | 42.6 | 28.2 | 1.035461 | 1.5106384 |
| Nerve chord | 21.3 | 38.6 | 40.1 | 0.5311721 | 0.9625935 |
| Poison sac | |||||
| Sting | 55.8 | 44.2 | 1.2624434 | ||
| Heart | 30.2 | 28.8 | 41 | 0.7365854 | 0.702439 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31 | 37.4 | 45.1 | 0.6873614 | 0.8292683 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAIMKILLRPDIVRFTGVRHLSIKPKFGLLFDIDGVLVRGKKVLPPVSEAFKQLQGKDGK FRVPTVFVTNSGNALRSQKAADLSKWIGFEVKESQVVMAHSPLKLFNQFHNKQVLISGQG PIKEIAKELGFQKTVTIQELVKNFPCLDYVNMEKRNPICGPVDPTFPRIEAIVLFSEPIS WETPLQLIIDLLMTNGMPTGLLDDIPYPHIPILACNMDLLWVSEAPIPRYGHGTFLLCLE SLYKKITGKDMIYTALIGKPSEITYYHANYMLHEHAKSIGIDNVNTIYAIGDNINTDIFG ANLYDKYLSYCAKEEALKSDKLKKLLDKDIKPPNAKACISILVETGVHQRDSDFISEHSP RDFLPVEDGLGKPAFIVKHVGEAINVAFKEEKFD |
 Top
| |