| Protein: 328793605 XP_623586.2 PREDICTED: farnesyl pyrophosphate synthase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 32 | 68 | 0.47058824 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 22.3 | 24.5 | 53.2 | 0.41917294 | 0.46052632 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 42.4 | 19.1 | 38.5 | 1.1012987 | 0.49610388 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 29.5 | 70.5 | 0.41843972 | ||
| Malpighian tubules | 29.7 | 38.6 | 31.7 | 0.93690854 | 1.2176657 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 58.4 | 41.6 | 1.4038461 | ||
| Heart | 36.8 | 63.2 | 0.5822785 | ||
| Hypopharyngeal gland | 51.2 | 48.8 | 1.0491803 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.2 | 37.3 | 51.9 | 0.6204239 | 0.7186898 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSKSNDLQHTDSLVKNESHKLMTLWPDIVRELTENNNQELQDVNEWTAKVLEYNVPKGG RRRSISLIVAYKLLASQDQLTEENIHSARILAWCMEILQAVYIVMDDIIDHTDMRRNQPT WHVKIGLSAVNDVLLIETCIYDLFKKYFKSKDCYIDILNLFSKYHKKTVQGECLDVLIST DWGKKSNLDLFSMDRYNTIVKHKTSYYSFVLPFVLAMRFAGITDPEIYKQAEKILLKIGH LFQVRDDYLDCYAKREVIGKSGTDIQEGKCTWLIVVALQRATAEQKKILKECYGIADEEK IKRVKEIYEEIGISNIYMDYEEETHNLLNTYTQQLSSKLPTEYFLYLLSTSCSKVGRKN |
 Top
| |