| Protein: 328790510 XP_624603.2 PREDICTED: dnaJ homolog subfamily B member 11-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.6 | 64.4 | 0.55279505 | ||
| Scape | 52 | 48 | 1.0833334 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 54.6 | 45.4 | 1.2026432 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.2 | 15.2 | 40.6 | 1.0886699 | 0.37438422 |
| Sternite | 12.2 | 36.6 | 51.2 | 0.23828125 | 0.71484375 |
| Tergite | 71.4 | 28.6 | 2.4965036 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.9 | 47.5 | 21.6 | 1.4305556 | 2.199074 |
| Malpighian tubules | 30.5 | 28.6 | 41 | 0.74390244 | 0.69756097 |
| Nerve chord | 66.8 | 33.2 | 2.0120482 | ||
| Poison sac | 3 | 97 | 0.030927835 | ||
| Sting | |||||
| Heart | 24.3 | 40.5 | 35.2 | 0.69034094 | 1.1505681 |
| Hypopharyngeal gland | 31.8 | 68.2 | 0.46627566 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.3 | 36.5 | 47.8 | 0.7803347 | 0.7635983 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFVVTSARMAAIKLIWSLFINLIICVVLTVAGRDFYAILGISSTASQHAIKKAYRKLAKE LHPDKNKDDPNASQKFQDLGAAYEVLSDNEKREMYDKCGEECLKKDGMMNNADPFASFFG DFGFHFGGESHHQQETPKGSNIIMDLVVTLEELYSGNFIEITRNKPVMKAAKGTRKCNCR QELVTRNLGNGRFQMMQQSVCSECPNVKFVTEERILEVEVEPGMVDGQETKFTAEGEPHL DGEPGDLILKIRTQPHPVFERIGDDLYTNITISMQDALIGFKMDIEHLDGHKVTIQRDKV TKPGARIRKKGEGMPNYENNNLHGTLYITFDVAFPETEFTDIQKEEIKNLLQQDSVNRIY NGISGS |
 Top
| |