| Protein: 328791709 XP_001120484.2 PREDICTED: nucleotide exchange factor SIL1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.5 | 45.5 | 1.1978022 | ||
| Scape | 40.9 | 59.1 | 0.69204736 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 39.6 | 60.4 | 0.65562916 | ||
| Leg, middle | 30.6 | 69.4 | 0.4409222 | ||
| Leg, rear | 47.7 | 31.7 | 20.6 | 2.3155339 | 1.5388349 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 65.6 | 10.3 | 24 | 2.7333333 | 0.42916667 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 58.9 | 41.1 | 1.43309 | ||
| Malpighian tubules | 37.8 | 24.1 | 38.2 | 0.9895288 | 0.6308901 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.3 | 32.5 | 44.8 | 1.1004465 | 0.7254464 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKNHNCILGEVLGQSQELIKMQANMIILTCLLLLPTIFGDIEKNETTFVPTREWQTVKKG TPIPGGLHVRHNFQTGVTEAKLMDSEDVEEKDLSENLNSSNINSLTLHPEKAIFEEKDPT EKSNLFHHPIEELKARLKKIKQDSGENIPELDDEHTQQIKKKFKDYETLKKEFKALEINI TTDSELLNNYFQKFHVHKNAITMGTLTTAETEEVLDILYNLEYLLHQIDNAKVFADMQGM SKIISPCLNGTNNEIKAEALRLLGAAVQSNPKVQLKALENDFVQKLLHILSTNNKMEIKS RCLFALSALIRQFPAAQKVWIDHGGVEIFGKILIDDQLQVQIKVMRLINDLIIERQNLNE ITDANQQLKIKAYATADIEKKLLTYEYCNHLSNLMIESFKGEHSDQLRTDNYEFLETISD SMITIAPICIDRFRENKDELLPIIRHLLNFYQNLNLLMDKLQTTGNSRDEL |
 Top
| |