| Protein: 66512107 XP_395163.2 PREDICTED: proteasome subunit beta type-1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.7 | 25.6 | 32.7 | 1.2752293 | 0.78287464 |
| Scape | 31 | 35.6 | 33.4 | 0.92814374 | 1.0658683 |
| Brain | 49.4 | 50.6 | 0.97628456 | ||
| Crop | 32 | 30.8 | 37.2 | 0.86021507 | 0.827957 |
| Eye | 56.2 | 43.8 | 1.283105 | ||
| Intestine | 20.8 | 44 | 35.2 | 0.59090906 | 1.25 |
| Leg, front | 38.4 | 32.6 | 29.1 | 1.3195876 | 1.1202749 |
| Leg, middle | 28.7 | 37.6 | 33.7 | 0.85163206 | 1.115727 |
| Leg, rear | 42 | 29.9 | 28.1 | 1.4946619 | 1.064057 |
| Mandibular gland | 42 | 58 | 0.7241379 | ||
| Rectum | 65.9 | 34.1 | 1.9325513 | ||
| Salivary gland, cerebral | 65.2 | 6.4 | 28.4 | 2.2957747 | 0.22535211 |
| Salivary gland, thoracic | 38.4 | 27 | 34.6 | 1.1098266 | 0.7803468 |
| Sternite | 22.9 | 48.1 | 29 | 0.78965515 | 1.6586207 |
| Tergite | 21.8 | 46.5 | 31.6 | 0.6898734 | 1.471519 |
| Ventriculus | 44.6 | 55.4 | 0.8050541 | ||
| Thoracic muscle | |||||
| Fat body | 27.7 | 35.2 | 37.1 | 0.7466307 | 0.94878703 |
| Malpighian tubules | 27.2 | 29.6 | 43.1 | 0.63109046 | 0.68677497 |
| Nerve chord | 29.3 | 30 | 40.7 | 0.71990174 | 0.7371007 |
| Poison sac | |||||
| Sting | 55.4 | 44.6 | 1.2421525 | ||
| Heart | 24.2 | 41 | 34.8 | 0.6954023 | 1.1781609 |
| Hypopharyngeal gland | 62.2 | 37.8 | 1.6455027 | ||
| Galea | 5.4* | 43.2 | 51.4 | 0.10505836 | 0.8404669 |
| Glossa | 5* | 57 | 38 | 0.13157895 | 1.5 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.2 | 40.6 | 38.4 | 0.7864583 | 1.0572916 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVSLSEIPGRSLSDYATEGAKMRNFNPYADNGGSVIALAGDNFCVIAADTRLSTGFSIYT REQQKLFPLSSKTVLGCSGCWCDTLTLTRILSARMQMYEHEHQKEMPTPAVAQMLSTMLY YKRFFPYYVSNILGGLDENGKGCVYSYDPIGHCEITKYRAGGSAGALLQPLLDNQIGYKN QEGVESVPLTQERAVAIIKDVFTSAAERDIYTGDSIFIKIITSDGIQNFNFALRKD |
 Top
| |