| Protein: 66565249 XP_625027.1 PREDICTED: elongation factor 1-beta |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 69.4 | 30.6 | 2.267974 | ||
| Scape | 27.8 | 44 | 28.2 | 0.9858156 | 1.5602837 |
| Brain | |||||
| Crop | 32.1 | 24.3 | 43.7 | 0.73455375 | 0.55606407 |
| Eye | 56.1 | 24 | 19.9 | 2.8190954 | 1.2060301 |
| Intestine | 61 | 39 | 1.5641025 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 57.8 | 42.2 | 1.3696682 | ||
| Rectum | |||||
| Salivary gland, cerebral | 56.9 | 12.1 | 31 | 1.8354839 | 0.3903226 |
| Salivary gland, thoracic | 41.8 | 20.1 | 38.2 | 1.0942408 | 0.526178 |
| Sternite | 39.3 | 33.8 | 26.8 | 1.4664179 | 1.261194 |
| Tergite | 78.1 | 21.9 | 3.56621 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 44.3 | 25.3 | 30.4 | 1.4572369 | 0.8322368 |
| Malpighian tubules | 22.3 | 37.4 | 40.3 | 0.55334985 | 0.9280397 |
| Nerve chord | 32.9 | 18.3 | 48.9 | 0.6728016 | 0.37423313 |
| Poison sac | |||||
| Sting | 55.6 | 44.4 | 1.2522522 | ||
| Heart | 28.2 | 37.6 | 34.2 | 0.8245614 | 1.0994152 |
| Hypopharyngeal gland | 27.6 | 72.4 | 0.38121548 | ||
| Galea | 21.4 | 29.4 | 49.2 | 0.43495935 | 0.597561 |
| Glossa | 22.2 | 77.8 | 0.28534704 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.5 | 33.9 | 39.9 | 1.0401002 | 0.84962404 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAIGDLKTDKGIKDLNSYLADHSYIEGWQPTQADVVILEALGKTPTSSNPHVLRWYNHIK SYDLKTLPGEKKTPVILGNNIAAGKNEEDDDKDVDLFESDEEEDPEAVRLREERLKEYAE KKSKKPILIAKSSVVLDVKPWDDETDMKAIEEIVRSIQMDGLTWAASKLVAVGYGIHKFR IMCIIEDDKVSVDSLIEQIESFEEYVQSVDIESFNKL |
 Top
| |