| Protein: 48095072 XP_397519.1 PREDICTED: hypothetical protein LOC408696 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.3 | 20.3 | 36.4 | 1.1895604 | 0.5576923 |
| Scape | 14.4* | 28.4 | 57.2 | 0.25174826 | 0.4965035 |
| Brain | 48.7 | 51.3 | 0.94931775 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 37.7 | 62.3 | 0.60513645 | ||
| Leg, rear | 36.1 | 63.9 | 0.5649452 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 22.9 | 77.1 | 0.29701686 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 14.7 | 56.5 | 28.8 | 0.5104167 | 1.9618056 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.5 | 35.5 | 53.9 | 0.5102041 | 0.6586271 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNFILIPFFLAANIPVDRPNEWIFGPVYVFNANFSYTVLADVLDEPLLSIHVTTTMRCRP KMIDRLYCSFDGIRVGERNYPEVSILDKSYSFLIEFSPRGVENLRFPTVMEDEGLNTVRN IVKQLSVGTDLRENVNSMPVFFSKERHALGDCPTLFSVFEYENARGQTRDEEEEGKNYKL EILPLPQRRSNSVVVIGKTMESSRCAKLQEPVDGKSELNVKMSKSTSKMHVSDDAFRSRT EMHVKMVNPAQRNFIVQDVSSVELVGIEPAEQPLPLLNYEHVVNLRFKEGIMHNLYMI |
 Top
| |