| Protein: 328782253 XP_623217.2 PREDICTED: nucleosome assembly protein 1-like 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 56.3 | 6.1 | 37.6 | 1.4973404 | 0.16223404 |
| Brain | |||||
| Crop | 39.1 | 60.9 | 0.64203614 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 25.9 | 38.6 | 35.4 | 0.73163843 | 1.0903955 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 39.8 | 60.2 | 0.6611296 | ||
| Malpighian tubules | 23.9 | 39.2 | 36.9 | 0.6476965 | 1.0623306 |
| Nerve chord | 46 | 54 | 0.8518519 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 29.6 | 33.1 | 37.3 | 0.7935657 | 0.88739944 |
| Hypopharyngeal gland | 44.4 | 55.6 | 0.79856116 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.8 | 33.5 | 47.2 | 0.779661 | 0.70974576 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTTDPERAGDNSEMESVEDEDDNKAPELFAKALNRSDMLAALQDRTAPGIEQMQNLPAPV KRRIKALKQLQLVTTNIEAKFYEEVHALECAYYKMCAPLYEKRSEIVSGVYEPTDEQCVW ESDDDEEGLTNDLKTKVNLEDDKEQKKEEHPRFWLTIFKNVETLADMVQEHDEAILKHLY DIRVIFLDNPMGFVLEFHFAPNEYFSNSVLTKEYIMKCTPDKNDPFSFEGPEIYKCKGCV IDWKKGKNVTVKTIKKNQKHKSRGSIRTVTKTVQNDSFFNFFSPPIVPEDSEAELDDETQ ALLSSDFEIGHYIRERIVPRAVLYYTGEGLEDEDEDYEEEEGDEDDPEEEDEDDEESSPN NAPPDQA |
 Top
| |