| Protein: 48142692 XP_393605.1 PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26 | 45.6 | 28.4 | 0.91549295 | 1.6056339 |
| Scape | 20 | 43.5 | 36.5 | 0.5479452 | 1.1917808 |
| Brain | 38.5 | 28.8 | 32.7 | 1.1773701 | 0.88073397 |
| Crop | 41.3 | 20.4 | 38.4 | 1.0755209 | 0.53125 |
| Eye | 10.8 | 36.2 | 53 | 0.20377359 | 0.68301886 |
| Intestine | 41.3 | 30.3 | 28.4 | 1.4542253 | 1.0669014 |
| Leg, front | 30.4 | 34.5 | 35.2 | 0.8636364 | 0.9801136 |
| Leg, middle | 30.6 | 35.2 | 34.2 | 0.8947368 | 1.0292398 |
| Leg, rear | 26 | 37.1 | 36.9 | 0.70460707 | 1.0054201 |
| Mandibular gland | 23 | 36.2 | 40.9 | 0.5623472 | 0.8850856 |
| Rectum | 44.2 | 21.5 | 34.3 | 1.2886298 | 0.6268222 |
| Salivary gland, cerebral | 28.3 | 40.3 | 31.4 | 0.9012739 | 1.2834395 |
| Salivary gland, thoracic | 32.8 | 35.6 | 31.6 | 1.0379747 | 1.1265823 |
| Sternite | 35.4 | 33 | 31.6 | 1.1202532 | 1.0443038 |
| Tergite | 32.2 | 41.5 | 26.4 | 1.219697 | 1.5719697 |
| Ventriculus | 25.1 | 32.9 | 42 | 0.59761906 | 0.78333336 |
| Thoracic muscle | 43.1 | 43.9 | 13 | 3.3153846 | 3.376923 |
| Fat body | 47 | 33.6 | 19.4 | 2.4226804 | 1.7319587 |
| Malpighian tubules | 33.1 | 33.7 | 33.2 | 0.99698794 | 1.0150602 |
| Nerve chord | 19.9 | 51.3 | 28.9 | 0.6885813 | 1.7750865 |
| Poison sac | 52.9 | 47.1 | 1.1231422 | ||
| Sting | 45.4 | 54.6 | 0.83150184 | ||
| Heart | 43.7 | 23.8 | 32.6 | 1.3404908 | 0.73006135 |
| Hypopharyngeal gland | 74.3 | 25.7 | 2.8910506 | ||
| Galea | 30.4 | 44.1 | 25.6 | 1.1875 | 1.7226562 |
| Glossa | 26.8 | 41.1 | 32.1 | 0.83489096 | 1.2803738 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.7 | 38.3 | 33.6 | 0.94345236 | 1.1398809 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKIGINGFGRIGRLVFRASIEFGAQVVAINDPFIGLEYMAYMLKYDSTHGKFKGDVKIE NDQLVVNGNKIAVFSEREAKNIPWTKAGAEYIVESTGVYTTKEKASGHLQAGAKKVVITA PSADAPMFVCGVNLDAYDPSYTIVSNASCTTNCLAPLAKVIHDNFEIVEGLMTTVHAVTA TQKVVDAPSAKLWRDGRGACQNIIPAATGAAKAVGKVIPALDGKLTGMAFRVPVHNVSVV DLTVRLGKGADYKTIKAKVKEASEGPLKGILGYTEDEVVSSDFIGDDHASIFDAKAGIAL NNNFVKLISWYDNEYGYSCRVIDLIKYMQSKEK |
 Top
| |