| Protein: 328786898 XP_624681.2 PREDICTED: hypothetical protein LOC552303 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 35.7 | 64.3 | 0.55520993 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 47 | 53 | 0.8867925 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 91.7 | 8.3 | 11.048193 | ||
| Salivary gland, thoracic | 35.7 | 22.2 | 42.1 | 0.847981 | 0.5273159 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.5 | 40.6 | 17.9 | 2.3184357 | 2.2681565 |
| Malpighian tubules | 32.7 | 26.7 | 40.6 | 0.8054187 | 0.65763545 |
| Nerve chord | 42.3 | 10.1 | 47.6 | 0.8886555 | 0.21218488 |
| Poison sac | |||||
| Sting | |||||
| Heart | 38.4 | 33.3 | 28.4 | 1.3521127 | 1.1725352 |
| Hypopharyngeal gland | 28.1 | 71.9 | 0.3908206 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47 | 30.5 | 41.6 | 1.1298077 | 0.7331731 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTDTQYSNYQQQGYNQYSQPPPSGGQDTSYPPPSSGGGGGYNQYSQPPPNSGSNYGSYNS YNSSGGPDYNQSQGQNSYNQNSYGSGGGSGNNSGSSNYGGNYGHGGGGGGSGYRNNSGGG YGGGQGGGGSSRYGDRGGYNDRSGGSYNSGGGRGGYNKGGYGDRGGGNDGMVTQEDTIFV SGMDPSISEEEICQHFGAIGIIKHDKRTGKPKVWMYKDKNTGKSKGEATVTYDDQNAARS AIDWFDGKEFKGKKIRVQIAQHKSNWQGNRSGGSRGGGGRGRGSGGFGSRGGGGDRDDHH RGGGDDRRDGGGRGGDWRCPNPECGNTNFAWRDQCNLCKSLKPEGAGGSGGGRGNRGGDR GGRGGFRSDRGGRGGDRGGRGGFRGGDRGGRGGRGGPMRAEETEIGIVSGHIRHNLKSD |
 Top
| |