| Protein: 66524874 XP_396338.2 PREDICTED: tubulin alpha chain testis-specific-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 7.6* | 92.4 | 0.08225108 | ||
| Scape | 17.7 | 34.9 | 47.4 | 0.37341774 | 0.73628694 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 15.9* | 40.9 | 43.1 | 0.3689095 | 0.9489559 |
| Leg, middle | 10.4* | 28 | 61.6 | 0.16883117 | 0.45454547 |
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 32.8 | 67.2 | 0.48809522 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 55.5 | 12.3 | 32.2 | 1.7236025 | 0.38198757 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.3 | 29 | 57.3 | 0.40663177 | 0.5061082 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTFGGDDSFSTFFNETSSGKH VPRAVFVDLEPTVVDEVRTGIYKHLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVIDR VRKLADQCTGLQGFLIFHSFGGGTGSGFASLLMERLSVEYGKKSKLEFAIYPAPRVSTAV VEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITAS LRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQ MVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPT VVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEA REDLAALEKDYEEVGLDSTDVEETDAIDEY |
 Top
| |