| Protein: 48120151 XP_396457.1 PREDICTED: leucine-rich repeat flightless-interacting protein 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 91.3* | 8.7 | 10.494253 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 89.8* | 10.2 | 8.803922 | ||
| Sternite | 52.6 | 47.4 | 1.1097046 | ||
| Tergite | |||||
| Ventriculus | 84.9 | 15.1 | 5.6225166 | ||
| Thoracic muscle | |||||
| Fat body | 98.5* | 1.5 | 65.666664 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 43.8* | 42.3* | 13.8 | 3.173913 | 3.0652175 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 77.9 | 67.4 | 16.1 | 4.838509 | 4.1863356 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MESAIAGRRRTTARHSAEDQALDQIAKEAEARLAARRQARAEAREIRMRELERQQKEAEE NADRVYDMCSADVNRTMRVTPDSVRTSRLLTNSNNFQSSRRSSEDSLEDAGLSRDLRLEL KEFEEKFRKAMIANAQLDNEKSSYAYQVDLLKDKLEELEETVAQLRRELREKNRESEQLK RLSQTLKDELDVCHAQLIERDTLIQENGLVIIDDEGSENEDNDIENGSRPRRRVLVSTEA AELLQNAGKGSLDVRLRKFASEKKELQDEIRHLRLELEETRNRIRSERSPGSVLGCLSDS EDVQREANKLLADYKFKLQKAEQDMSTLQATVARLESQVIRYKSAAEASEKAEDELKVEK RKLQREVRETQGRVEELETANSHLQRRLDKLKNAKSALLKEL |
 Top
| |