| Protein: 328786572 XP_001120798.2 PREDICTED: hypothetical protein LOC726321 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23.9 | 36 | 40.1 | 0.59600997 | 0.8977556 |
| Scape | 43.8 | 16.6 | 39.6 | 1.1060606 | 0.41919193 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 23.8 | 76.2 | 0.31233597 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 84.5* | 3.1* | 12.5 | 6.76 | 0.248 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 24.6 | 38.2 | 37.2 | 0.66129035 | 1.0268817 |
| Poison sac | |||||
| Sting | |||||
| Heart | 16.2 | 30.7 | 53.1 | 0.30508474 | 0.57815444 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.1 | 24.9 | 43.1 | 0.837587 | 0.57772624 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRRIGILVVCLLVVLGFYGHVATLIFISLTVRGINAMQCYLCNSHNDSRCADENPPDALK KDCSDLKNGAKYTMCRKITQVIEFSVNGLPPDTRVIRGCGWDESNYKGKCYQRSGFGGRQ EVCSCLTDFCNTATPSVLPPTSLIASCVAASVLLAYIRNN |
 Top
| |