| Protein: 110756506 XP_394545.2 PREDICTED: dnaJ protein homolog 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 60.9* | 16.6 | 22.5 | 2.7066667 | 0.73777777 |
| Scape | 22.8 | 27 | 50.2 | 0.45418328 | 0.5378486 |
| Brain | |||||
| Crop | 29 | 26.9 | 44.2 | 0.6561086 | 0.6085973 |
| Eye | |||||
| Intestine | 51.8 | 48.2 | 1.0746888 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 7.6 | 92.4 | 0.08225108 | ||
| Rectum | |||||
| Salivary gland, cerebral | 19.2 | 80.8 | 0.23762377 | ||
| Salivary gland, thoracic | 53.3 | 16.1 | 30.6 | 1.7418301 | 0.5261438 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 55.9 | 24.6 | 19.5 | 2.8666666 | 1.2615385 |
| Malpighian tubules | 36.2 | 35.5 | 28.3 | 1.2791519 | 1.254417 |
| Nerve chord | 42 | 19.4 | 38.6 | 1.0880829 | 0.50259066 |
| Poison sac | |||||
| Sting | |||||
| Heart | 30.1 | 38.1 | 31.7 | 0.9495268 | 1.2018927 |
| Hypopharyngeal gland | 43 | 57 | 0.75438595 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.5 | 28.9 | 45.3 | 0.8278146 | 0.6379691 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGKDYYKILGINKNATDDEIKKAYRKLALKYHPDKNRSAGAEEKFKEIAEAYEVLSDAKK REVYDKFGEEGLKGGAGSAGGGGGGTTYTFHGDPKATFAQFFGSASPFQTFFEFGDDPLG LGVGPQRQSGQSGAFRSHSFNFVGPNSGRGGNKDRAQDPAIEHDLYISLEEILRGCTKKM KISKRVVQPDGSTKKEDKVLTINVKPGWKAGTKITFQKEGDQGRGKVPADIVFIIRDKPH PLFRREGSDIRYTCKLSLKQALCGTVIEVPTLIGEKINLNLTREIVKPNMVRRIQGHGLP FPKEPSRKGDLLVSFDIKFPETLSQSAKDILYDTLPN |
 Top
| |