| Protein: 110755382 XP_623524.2 PREDICTED: 40S ribosomal protein S15Aa-like isoform 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.7 | 69.3 | 0.44300145 | ||
| Scape | 39.1 | 29.4 | 31.5 | 1.2412698 | 0.93333334 |
| Brain | |||||
| Crop | 13 | 47.7 | 39.4 | 0.32994923 | 1.2106599 |
| Eye | |||||
| Intestine | 27.5 | 31.3 | 41.1 | 0.66909975 | 0.76155716 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.6 | 17.2 | 49.1 | 0.6843177 | 0.3503055 |
| Sternite | |||||
| Tergite | 69.7 | 23.1 | 7.2 | 9.680555 | 3.2083333 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.5 | 40.3 | 28.2 | 1.1170213 | 1.429078 |
| Malpighian tubules | 40.8 | 21.3 | 37.9 | 1.0765171 | 0.5620053 |
| Nerve chord | 58 | 8.1 | 33.8 | 1.7159764 | 0.23964497 |
| Poison sac | |||||
| Sting | 12.2 | 87.8 | 0.13895217 | ||
| Heart | 22.5 | 44.1 | 33.4 | 0.6736527 | 1.3203592 |
| Hypopharyngeal gland | 18.2 | 81.8 | 0.22249389 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.3 | 27 | 45.1 | 0.827051 | 0.59866965 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVRMNVLSDALKSINNAEKRGKRQVLLRPCSKVIIKFLTVMMRKGYIGEFEIVDDHRSGK VVVNLSGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKH LGGKILGFFF |
 Top
| |