| Protein: 66506995 XP_623525.1 PREDICTED: protein FAM162B-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.5 | 45.5 | 1.1978022 | ||
| Scape | 40.1 | 16.1 | 43.8 | 0.91552514 | 0.3675799 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 47.6 | 52.4 | 0.90839696 | ||
| Leg, front | 47.8 | 52.2 | 0.91570884 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 11 | 55.5 | 33.4 | 0.32934132 | 1.6616766 |
| Rectum | |||||
| Salivary gland, cerebral | 19.8 | 80.2 | 0.2468828 | ||
| Salivary gland, thoracic | 40.3 | 59.7 | 0.67504185 | ||
| Sternite | 16.3 | 28.6 | 55.1 | 0.29582578 | 0.51905626 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 48.3 | 51.7 | 0.934236 | ||
| Fat body | 22.5 | 33.2 | 44.3 | 0.50790066 | 0.74943566 |
| Malpighian tubules | 34.1 | 27.3 | 38.6 | 0.8834197 | 0.7072539 |
| Nerve chord | 31.3 | 32.4 | 36.3 | 0.862259 | 0.892562 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 31.2 | 26.8 | 42 | 0.74285716 | 0.63809526 |
| Glossa | 42.8 | 27.8 | 29.4 | 1.4557823 | 0.9455782 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.9 | 33 | 47.5 | 0.7136842 | 0.69473684 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFSTRLIRQFKCFKIRQLHSTFVKNENKPVTETSKIKTETSKSTNVSQAEKEAIEFVSGE SLYTLTNFDKRILVWVKRFPSMDKVPKQVSIRTIQLAHTKARIKVCFYMMAFAIIGSILA VMSGKRDVAAGKNLLTERQKWYDQVKEKARKEAEMAEKNEK |
 Top
| |