![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66544702 XP_623832.1 PREDICTED: t-complex protein 1 subunit theta-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.6 | 17.3* | 55.1 | 0.5009074 | 0.3139746 |
| Scape | 33.4 | 31.6 | 35 | 0.95428574 | 0.9028571 |
| Brain | 53.5 | 46.5 | 1.1505376 | ||
| Crop | 36.3 | 29.4 | 34.3 | 1.0583091 | 0.85714287 |
| Eye | |||||
| Intestine | 25.3 | 39.3 | 35.4 | 0.71468925 | 1.1101695 |
| Leg, front | 47.3 | 52.7 | 0.8975332 | ||
| Leg, middle | 35.1 | 25.4 | 39.5 | 0.8886076 | 0.643038 |
| Leg, rear | 39.6 | 28.5 | 31.9 | 1.2413793 | 0.89341694 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 61.4 | 38.6 | 1.5906736 | ||
| Salivary gland, thoracic | 28 | 38.3 | 33.7 | 0.83086056 | 1.1364986 |
| Sternite | |||||
| Tergite | 82.6 | 17.4 | 4.7471266 | ||
| Ventriculus | 15.2 | 84.8 | 0.17924528 | ||
| Thoracic muscle | |||||
| Fat body | 40.6 | 26.5 | 32.9 | 1.2340425 | 0.8054711 |
| Malpighian tubules | 33.6 | 27.9 | 38.6 | 0.8704663 | 0.72279793 |
| Nerve chord | 21.2 | 40.9 | 37.9 | 0.55936676 | 1.0791557 |
| Poison sac | |||||
| Sting | 53.5 | 46.5 | 1.1505376 | ||
| Heart | 20.2 | 35.9 | 43.9 | 0.46013668 | 0.8177677 |
| Hypopharyngeal gland | 31.7 | 68.3 | 0.46412885 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 33 | 42.9 | 0.8857809 | 0.7692308 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAFHVPKAPGMAQMLKEGARYFSGLEEAVYGNISACKQFAQTVRTAYGPNGMNKMIINHI EKLFITNDAATIINELEVEHPAAKLIVLASKMQEAEVGDGTNFVIIFAGALLEAAEELLR LGITTSEIVEGYEASLEKVLQILPTLVCYEIKDYKDEKQIKMGIKTAIMSKQYGNEEPLT SLVAQACISILPKKSTFNVDNVRVCKILGSGISSSEVVQGMVFKRQVEGDVTRKDNSKIV VYTCAVDIIQTETKGTVLIKTADELMKFSRGEESLLESQIKAIADSGASVIVSGGKFGDM ALHYMNKYNLMAVRIPSKFDIRRLCKTVGATALSKLAPPSKEELGYADSVYIDEVGDTIV VKFAISGKDSRVSTIIVRGSTENYMDDIERAIDDGVNTFKGITRDGRFVPGAGATEIELA SQLSTYADTLPGLEQYAVRRFATALEVFPKTLAENSGSYASELLSKLYSAHKEGKKNYGF NIDQKGGLIDTVESGILDLFLTKQWGLKYAVGVACTVLKVNQIIMAKRAGGPKVPGGGIR DDDE |
|
| |