| Protein: 328780825 XP_624392.3 PREDICTED: hypothetical protein LOC552009 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.4 | 66.6 | 0.5015015 | ||
| Scape | 40.3 | 19.6 | 40.1 | 1.0049875 | 0.48877805 |
| Brain | 55.4 | 17.7 | 26.9 | 2.0594795 | 0.65799254 |
| Crop | 33 | 37.9 | 29 | 1.137931 | 1.3068966 |
| Eye | |||||
| Intestine | 35.7 | 27.5 | 36.8 | 0.9701087 | 0.7472826 |
| Leg, front | 37.6 | 20.6 | 41.8 | 0.8995215 | 0.49282297 |
| Leg, middle | 41.4 | 17.7 | 40.9 | 1.0122249 | 0.43276283 |
| Leg, rear | 20.7 | 29.2 | 50 | 0.414 | 0.584 |
| Mandibular gland | 51.1 | 48.9 | 1.0449898 | ||
| Rectum | 27 | 14 | 58.9 | 0.45840406 | 0.237691 |
| Salivary gland, cerebral | 9.8 | 50.2 | 40 | 0.245 | 1.255 |
| Salivary gland, thoracic | 31.3 | 35 | 33.7 | 0.92878336 | 1.0385756 |
| Sternite | 35.1 | 29.5 | 35.3 | 0.9943343 | 0.8356941 |
| Tergite | 73.2 | 26.8 | 2.7313433 | ||
| Ventriculus | |||||
| Thoracic muscle | 60.7 | 39.3 | 1.5445293 | ||
| Fat body | 34.7 | 32 | 33.4 | 1.0389222 | 0.9580838 |
| Malpighian tubules | 33.4 | 37.9 | 28.7 | 1.163763 | 1.3205575 |
| Nerve chord | 32.3 | 29.1 | 38.6 | 0.8367876 | 0.753886 |
| Poison sac | |||||
| Sting | 61.2 | 38.8 | 1.5773196 | ||
| Heart | 36.9 | 28.2 | 34.9 | 1.0573066 | 0.8080229 |
| Hypopharyngeal gland | 59.9 | 40.1 | 1.4937656 | ||
| Galea | 27.2 | 72.8 | 0.37362638 | ||
| Glossa | 41 | 19.1 | 39.8 | 1.0301508 | 0.4798995 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.2 | 31.2 | 41 | 0.9317073 | 0.7609756 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQRTLFFKKFLMPCGLCAAVPAMKPPIPEEHPAPCSNEIQGKKLIKPSELPIYSIDDGYT KQMPCIQYPSIVEDNIRKIRQTVSEIKLTIDKISRDISSSLESLKFISDYLQDQANLMPR IGAVGVGGLSGLILSLRGGIFKRLMYTTTGAAIVGCVCFPKETKETVNTMEHYGNVSYNF IYGVKPGDNKKEISFNEFPLVKSVLESEYFRMLVQFFEQKTNDTPTTTDVVLTDTTAKTE INKKK |
 Top
| |