| Protein: 328781230 XP_624310.2 PREDICTED: protein NPC2 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.7 | 32.1 | 30.2 | 1.2483444 | 1.0629139 |
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 85.7* | 14.3 | 5.993007 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 1.1 | 80.6 | 18.3 | 0.06010929 | 4.4043717 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 37.4 | 62.6 | 0.5974441 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 18.5 | 65 | 16.4 | 1.1280488 | 3.9634147 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 18.9* | 74.7* | 6.4 | 2.953125 | 11.671875 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 63.1 | 24.7 | 1.3441296 | 2.5546558 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYRMIVIILIVCLCFSPMYRAINIDDCGSKVGKLTSITLDCDMTKSVCDLIPDTNATIRI DFTLEKDVSKVNAIVHGIVMDIPIPFPLPNADACQTPDSGITCPLNKGETYHYKNTLPVH KSYPKVSVTVKWQLKDENNEDIICVLIPARIK |
 Top
| |