| Protein: 66534675 XP_624740.1 PREDICTED: protein lin-7 homolog B-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.6 | 57.4 | 0.74216026 | ||
| Scape | |||||
| Brain | 37.1 | 62.9 | 0.5898251 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 69.5 | 30.5 | 2.2786884 | ||
| Sternite | 73.8 | 26.2 | 2.816794 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 55.7 | 44.3 | 1.2573364 | ||
| Nerve chord | 60.7 | 10.5 | 28.7 | 2.1149826 | 0.36585367 |
| Poison sac | |||||
| Sting | |||||
| Heart | 61.4 | 38.6 | 1.5906736 | ||
| Hypopharyngeal gland | |||||
| Galea | 44.9 | 55.1 | 0.81488204 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 60.6 | 30.8 | 43 | 1.4093024 | 0.7162791 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVTMGEPLTLANDVKRSIELLDKLQKGGEVPATKLAALQKVLQSDFLSAVREVYEHVYET VDIQGSQDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS RIIPGGVADRHGGLKRGDQLLSVNGVCVEGENHEKAVELLKQAQNSVKLVVRYTPRVLEE MELRFDKQRAARRRQHMQ |
 Top
| |