![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328782156 XP_624150.2 PREDICTED: nitrilase homolog 1-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.4 | 36.1 | 28.5 | 1.2421052 | 1.2666667 |
| Scape | 40.8 | 23.1 | 36 | 1.1333333 | 0.64166665 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 32.3 | 67.7 | 0.47710487 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.1 | 38.5 | 35.4 | 0.7372881 | 1.0875707 |
| Sternite | 58.1 | 41.9 | 1.3866348 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.3 | 30.4 | 38.3 | 0.8172324 | 0.79373366 |
| Malpighian tubules | 39.7 | 28.1 | 32.2 | 1.2329192 | 0.8726708 |
| Nerve chord | 10.8 | 69.9 | 19.2 | 0.5625 | 3.640625 |
| Poison sac | |||||
| Sting | |||||
| Heart | 3.7 | 68.8 | 27.5 | 0.13454546 | 2.5018182 |
| Hypopharyngeal gland | 49.5 | 50.5 | 0.980198 | ||
| Galea | 63.1 | 36.9 | 1.7100271 | ||
| Glossa | 70.4 | 29.6 | 2.3783784 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.5 | 48.7 | 37 | 0.7432432 | 1.3162162 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAEEGKKVSFGFAKSIKKPVLKNIMPQEEKKVDYIECLDEKNIKVIGEEEKKDEPLVIPL LGSKTWHDRIINHIDADIFEPKENKEKTGDININKEIKSKLSNGNASPQIITKEPEQLVD NKVVTLEEQAAKEIIEELKSKEQQETKTNDFTLPLVEDQSLRGQEQSTLEDYERIPVDVY GFAMLRGMGWQPGKGIGRNEKVVSAVIPELRPKGMGLGADKVTQQKNTSSNKQEEELKIE KGTFVKIIAGKQSNNYGQIEGFDDDAGRLIIKLALGGSIISVNEFMVQPVTKSEYSKNSK VLTFRLSLVQLEVHEEKTKNIEKAVSYISSAKKQNADIVALPECFNSPYGLQYFPKYAEH IPDGETSVALSKAAKENNVYVVGGTIPERDGDKLFNTCTIWGPDGTLIAKHRKIHLFDID IPDKITFRESDSLSSGNSLTMFEVKNCKIGIGICYDIRFEEMARIYRNKGCQMLIYPAAF NLTTGPLHWSLLQRSRANDNQLYIAGISPARNPSASYVAWGHTQLTSPWGEILHDLETHE SMVVTDIDLKIVEEVRAQIPIFYQRRTDLYDTIWKKD |
|
| |