| Protein: 328782818 XP_624271.2 PREDICTED: protein DJ-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.8 | 33.4 | 27.8 | 1.3956834 | 1.2014389 |
| Scape | 28.7 | 30.3 | 40.9 | 0.7017115 | 0.7408313 |
| Brain | 51.2 | 48.8 | 1.0491803 | ||
| Crop | 57.3 | 19.4 | 23.3 | 2.4592276 | 0.832618 |
| Eye | 25.1 | 30.7 | 44.1 | 0.569161 | 0.6961451 |
| Intestine | 39.6 | 34.1 | 26.3 | 1.5057034 | 1.2965779 |
| Leg, front | 36.9 | 35.9 | 27.1 | 1.3616236 | 1.3247232 |
| Leg, middle | 33.7 | 36.6 | 29.7 | 1.1346802 | 1.2323233 |
| Leg, rear | 32.2 | 38.2 | 29.6 | 1.0878378 | 1.2905406 |
| Mandibular gland | 10.5 | 59.3 | 30.2 | 0.34768212 | 1.9635762 |
| Rectum | 61.9 | 38.1 | 1.6246719 | ||
| Salivary gland, cerebral | 32.5 | 21.6 | 45.8 | 0.709607 | 0.47161573 |
| Salivary gland, thoracic | 40.1 | 25.2 | 34.8 | 1.1522988 | 0.7241379 |
| Sternite | 33.4 | 38.4 | 28.2 | 1.1843972 | 1.3617021 |
| Tergite | 46 | 31.7 | 22.3 | 2.0627804 | 1.4215246 |
| Ventriculus | 57 | 43 | 1.3255814 | ||
| Thoracic muscle | 12 | 75.7 | 12.3 | 0.9756098 | 6.1544714 |
| Fat body | 64.6 | 17.5 | 17.9 | 3.6089385 | 0.9776536 |
| Malpighian tubules | 36.8 | 37.7 | 25.5 | 1.4431373 | 1.4784313 |
| Nerve chord | 27.4 | 45.2 | 27.4 | 1 | 1.6496351 |
| Poison sac | |||||
| Sting | 59.9 | 40.1 | 1.4937656 | ||
| Heart | 41.5 | 32.8 | 25.8 | 1.6085272 | 1.2713178 |
| Hypopharyngeal gland | 44.1 | 55.9 | 0.7889088 | ||
| Galea | 13.6 | 46.2 | 40.2 | 0.33830845 | 1.1492537 |
| Glossa | 17.5 | 48.4 | 34 | 0.5147059 | 1.4235294 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.8 | 39.6 | 32.8 | 1.0609756 | 1.2073171 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASIRMSVLCRVLPHFAQSICKIPILLHLKANYTVDMTKKTAILLIADGSEEMEAVITTD ILRRAGVDVTVAGLTENPYVNCSRNVKIHVDAKLQDVINQKYDVVILPGGLDGSKAFASS AEVGKLLQRQQEENRFIAAICAAPTALKAHGIAKGKQITSYPAMKDQLVDYYKYLENKVV IDDNLITSRGPATAFAFGLAIAEKLIDKQTADNVAQAMLYVQ |
 Top
| |