![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328790461 XP_623831.2 PREDICTED: protein disulfide-isomerase |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 55.2* | 20.8 | 24 | 2.3 | 0.8666667 |
| Scape | 34.7 | 38.5 | 26.8 | 1.2947761 | 1.4365672 |
| Brain | 41.1 | 34.1 | 24.8 | 1.657258 | 1.375 |
| Crop | 26.7 | 37.7 | 35.5 | 0.7521127 | 1.0619718 |
| Eye | 57.9 | 15.9 | 26.2 | 2.2099237 | 0.60687023 |
| Intestine | 39.4 | 43 | 17.7 | 2.2259886 | 2.4293785 |
| Leg, front | 32.9 | 43.8 | 23.3 | 1.4120172 | 1.8798283 |
| Leg, middle | 24.4 | 50.1 | 25.5 | 0.95686275 | 1.9647058 |
| Leg, rear | 30 | 48.4 | 21.5 | 1.3953488 | 2.2511628 |
| Mandibular gland | 21.4 | 78.6 | 0.27226463 | ||
| Rectum | 33.7 | 36.6 | 29.7 | 1.1346802 | 1.2323233 |
| Salivary gland, cerebral | 84.2 | 6.9 | 8.9 | 9.460674 | 0.7752809 |
| Salivary gland, thoracic | 50.9 | 15.6 | 33.5 | 1.519403 | 0.46567163 |
| Sternite | 25.9 | 50.4 | 23.7 | 1.092827 | 2.1265824 |
| Tergite | 14.1 | 66.9 | 19 | 0.74210525 | 3.5210526 |
| Ventriculus | 32.6 | 46.7 | 20.6 | 1.5825243 | 2.2669902 |
| Thoracic muscle | 54 | 46 | 1.173913 | ||
| Fat body | 40.6 | 38.9 | 20.5 | 1.9804878 | 1.897561 |
| Malpighian tubules | 33.7 | 33.8 | 32.5 | 1.036923 | 1.04 |
| Nerve chord | 42.6 | 30.4 | 27.1 | 1.5719557 | 1.1217712 |
| Poison sac | 48.3 | 51.7 | 0.934236 | ||
| Sting | 53.1 | 46.9 | 1.1321962 | ||
| Heart | 17.8 | 51.5 | 30.7 | 0.57980454 | 1.6775244 |
| Hypopharyngeal gland | 38.8 | 61.2 | 0.63398695 | ||
| Galea | 41.6 | 19.3 | 39.1 | 1.0639386 | 0.49360615 |
| Glossa | 38.1 | 22.1 | 39.8 | 0.9572864 | 0.5552764 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 37.2 | 32.1 | 1.1838006 | 1.1588784 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIFALTIVIICFFTFSLAKIEIEDSVLVLTKDNIEEAIEQNDYLLIEFYAPWCGHCKAL APEYAKAAKKLQDGGFPIKLAKVDAIIETELAEKHGVRGYPTLKFYRKGSAIDYSGGRQA DDIVNWVIKKSGPAAKNLSTVEEAKSFIESHNIAIIGFFKDIESDGAKVFLEVGNAVDDH VFGISNNDKVFNEYGVEDGKIVLFKKFDEGRKEFNEELDVKKLQNFISVHSLPLVVDFNQ DTVQKIFSGDIKSHLLVFLSKEAAGHFEEYVDKIKEPAKKFRGEVLFVTINADESDHERI LEYFGMKKSEVPAMRIIKFEQIMAKYKPEKPEISSENVLEFVTAFIEGKLKRHFLTQDLP EDWDKNPVKVLVGTNFHEVAYDKKKNVLVEFYAPWCGHCKQLAPIYEALGEKYKDSENLV IAKMDATANELKDVKVSSYPTITLYKKETNEAVEYNGERTLEGLSKFIDSDGAYGQAAEE KQDSRVTMEDLQNFNLSKLIKFLHRTLILTEEVKTILKANCEEAMYCLQPWCVEVNPQQE VNKSICTCLKVRLLHEDEEIAADISRTLLQTQQLREKSSLNNLKDIKAMYAKLNSAWKMY EVKKFNNEYILKNESYKELSVISNVTQYMSNGIWNLFYNSNFEGMSEICCIRYTNKEQLL LFFDIMQKFQYIQYYNDLIKIIVDDILPNMKIFDYTQLEYVKIYKMISILYQGLDPKIPI LVRINK |
|
| |