| Protein: 328778804 XP_624305.2 PREDICTED: SH3 domain-binding glutamic acid-rich protein homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.4 | 35.3 | 27.4 | 1.3649635 | 1.2883211 |
| Scape | 39.3 | 26.4 | 34.3 | 1.1457726 | 0.7696793 |
| Brain | 48.6 | 51.4 | 0.9455253 | ||
| Crop | |||||
| Eye | 71.7 | 28.3 | 2.5335689 | ||
| Intestine | 30.9 | 36.1 | 33 | 0.93636364 | 1.0939394 |
| Leg, front | 42.5 | 27.6 | 29.9 | 1.4214047 | 0.9230769 |
| Leg, middle | 34.6 | 35.3 | 30.1 | 1.1495017 | 1.1727575 |
| Leg, rear | 30.1 | 42 | 27.9 | 1.078853 | 1.5053763 |
| Mandibular gland | 3.8 | 96.2 | 0.03950104 | ||
| Rectum | |||||
| Salivary gland, cerebral | 11.3 | 88.7 | 0.12739572 | ||
| Salivary gland, thoracic | 46.8 | 26.1 | 27.1 | 1.7269373 | 0.96309966 |
| Sternite | 60.2 | 25.8 | 14 | 4.3 | 1.8428571 |
| Tergite | |||||
| Ventriculus | 67 | 33 | 2.030303 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 36.4 | 39.4 | 24.2 | 1.5041323 | 1.6280992 |
| Nerve chord | 34.6 | 34.2 | 31.1 | 1.1125402 | 1.0996785 |
| Poison sac | |||||
| Sting | |||||
| Heart | 47.9 | 23.4 | 28.7 | 1.6689895 | 0.815331 |
| Hypopharyngeal gland | |||||
| Galea | 33.5 | 66.5 | 0.5037594 | ||
| Glossa | 46.9 | 19.7 | 33.4 | 1.4041916 | 0.5898204 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.8 | 33.2 | 39.2 | 1.0153061 | 0.8469388 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVVKIYISGISGNKEVKKRQQRVLMILDSKNVEYETIDITEPGKEMEKEFMQANSIARES KYPLPPQIFNEEEYCGDYEDFDLANEIDELEEFLKVAPPVSAKENVIDLNQSKEIQENGN TTSREPSTDKEATAVETESVEKRTTLSSENVQSDESKSIEHGGETNTEESAEHTEENVEK NEEKSDDQEKEE |
 Top
| |