| Protein: 328776427 XP_625135.3 PREDICTED: cathepsin L-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.9 | 59.1 | 0.69204736 | ||
| Scape | 24.1 | 36.9 | 39 | 0.6179487 | 0.9461538 |
| Brain | 38.1 | 61.9 | 0.6155089 | ||
| Crop | 68.3 | 31.7 | 2.1545742 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 88.7* | 11.3 | 7.8495574 | ||
| Leg, middle | 39.4 | 40.1 | 20.5 | 1.9219512 | 1.9560976 |
| Leg, rear | 27.9 | 48.1 | 24 | 1.1625 | 2.0041666 |
| Mandibular gland | 7.3 | 92.7 | 0.07874865 | ||
| Rectum | |||||
| Salivary gland, cerebral | 76.7 | 23.3 | 3.2918456 | ||
| Salivary gland, thoracic | 16.6* | 30.9 | 52.5 | 0.31619048 | 0.5885714 |
| Sternite | 84.4* | 15.6 | 5.4102564 | ||
| Tergite | 4.4 | 24.9 | 70.8 | 0.062146895 | 0.3516949 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 5 | 15.3 | 79.7 | 0.06273526 | 0.19196989 |
| Malpighian tubules | 26 | 35.1 | 38.9 | 0.66838044 | 0.90231365 |
| Nerve chord | 5.8* | 41.4 | 52.8 | 0.10984848 | 0.78409094 |
| Poison sac | |||||
| Sting | 19.6 | 80.4 | 0.24378109 | ||
| Heart | 17.4 | 47.2 | 35.4 | 0.4915254 | 1.3333334 |
| Hypopharyngeal gland | 32.1 | 67.9 | 0.47275406 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 24.3 | 43.4 | 47.6 | 0.5105042 | 0.9117647 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIRKLGDAVVQQKLTNDESRTHAVSFFELVNQEWMTFKMEHKKVYKSDVEERFRMKIFMD NKHKIAKHNSNYEMKKVSYKLKMNKYGDMLHHEFVNILNGFNKSINTQLRSERLPVGASF IEPANVVLPKKVDWRKEGAVTPVKDQGHCGSCWSFSATGALEGQHFRRTGVLVSLSEQNL IDCSGKYGNNGCNGGLMDQAFQYIKDNKGLDTEASYPYEAENDKCRYNPANSGAIDVGYI DIPTGDEKLLKAAVATIGPVSVAIDASHQSFQFYSEGVYYEPECSSEELDHGVLVIGYGT NENGQDYWLVKNSWGETWGNNGYIKMARNKLNHCGIASSASYPLVGSKGLL |
 Top
| |