| Protein: 66554156 XP_625078.1 PREDICTED: ATP synthase subunit gamma mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.5 | 30.2 | 34.3 | 1.0349854 | 0.88046646 |
| Scape | 38.2 | 29 | 32.9 | 1.1610942 | 0.88145894 |
| Brain | 62.2 | 16.6 | 21.2 | 2.9339623 | 0.7830189 |
| Crop | 32.6 | 34.4 | 33 | 0.9878788 | 1.0424242 |
| Eye | 41.6 | 19.4 | 39 | 1.0666667 | 0.4974359 |
| Intestine | 32.3 | 30.9 | 36.8 | 0.8777174 | 0.83967394 |
| Leg, front | 33 | 27.6 | 39.3 | 0.8396947 | 0.70229006 |
| Leg, middle | 31.8 | 32.2 | 36 | 0.8833333 | 0.89444447 |
| Leg, rear | 23.8 | 33.5 | 42.7 | 0.55737704 | 0.78454334 |
| Mandibular gland | 77.2 | 1.6 | 21.1 | 3.6587677 | 0.07582939 |
| Rectum | 77* | 11.1 | 11.9 | 6.470588 | 0.9327731 |
| Salivary gland, cerebral | 31.5 | 34.6 | 33.9 | 0.9292035 | 1.020649 |
| Salivary gland, thoracic | 29.7 | 39.9 | 30.5 | 0.9737705 | 1.3081967 |
| Sternite | 38.5 | 27.6 | 33.8 | 1.1390532 | 0.8165681 |
| Tergite | 36.8 | 28.9 | 34.3 | 1.0728863 | 0.8425656 |
| Ventriculus | 49.1 | 50.9 | 0.96463656 | ||
| Thoracic muscle | 31.4 | 42.5 | 26.1 | 1.2030652 | 1.6283525 |
| Fat body | 34.3 | 42.5 | 23.3 | 1.472103 | 1.8240343 |
| Malpighian tubules | 38.4 | 27.5 | 34.1 | 1.1260997 | 0.8064516 |
| Nerve chord | 25.8 | 24.9 | 49.3 | 0.5233266 | 0.505071 |
| Poison sac | |||||
| Sting | 39.7 | 60.3 | 0.6583748 | ||
| Heart | 47.9 | 16.3 | 35.8 | 1.3379889 | 0.45530728 |
| Hypopharyngeal gland | 89.1 | 10.9 | 8.174312 | ||
| Galea | 49.8 | 25.8 | 24.4 | 2.0409837 | 1.0573771 |
| Glossa | 41.7 | 25.6 | 32.7 | 1.2752293 | 0.78287464 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.5 | 31.2 | 33.1 | 1.223565 | 0.94259816 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFSNHMKTLVQLVVQQQQQQRGMATLKAISIRLKSVKNIQKITQSMKMVSAAKYNRAERD LKQARPLGVGTKIFYEQAEIQAPPEDEKKLVVAITSDRGLCGAVHTGVSRNIRDSLLADP KERENTKIICVGEKSRAILSRLFANNILFVASEVGRKPPTFNDAAKVAIEIMNSGYSFGS GRIVYNRFKSVVSYSVDQLPLFDKNAVVSAPKLSLYDSLDENVIQSYLEFSLASLLFYSM KEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRELIEIISGAAALD |
 Top
| |