| Protein: 66535742 XP_395851.2 PREDICTED: cytosolic non-specific dipeptidase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.1 | 41.9 | 29 | 1.0034482 | 1.4448276 |
| Scape | 31.1 | 35.4 | 33.5 | 0.9283582 | 1.0567164 |
| Brain | 44.8 | 55.2 | 0.8115942 | ||
| Crop | 40.7 | 26.9 | 32.4 | 1.2561729 | 0.8302469 |
| Eye | |||||
| Intestine | 35.6 | 35.2 | 29.2 | 1.2191781 | 1.2054795 |
| Leg, front | 33.5 | 40.6 | 26 | 1.2884616 | 1.5615385 |
| Leg, middle | 34.2 | 37.1 | 28.7 | 1.1916376 | 1.2926829 |
| Leg, rear | 48.1 | 32.9 | 18.9 | 2.5449736 | 1.7407408 |
| Mandibular gland | 22 | 32.6 | 45.4 | 0.4845815 | 0.7180617 |
| Rectum | 29.8 | 47.8 | 22.4 | 1.3303572 | 2.1339285 |
| Salivary gland, cerebral | 32.3 | 19 | 48.7 | 0.66324437 | 0.39014372 |
| Salivary gland, thoracic | 30.6 | 29.7 | 39.8 | 0.76884425 | 0.74623114 |
| Sternite | 34.4 | 43.4 | 22.1 | 1.5565611 | 1.9638009 |
| Tergite | 20.3 | 65.9 | 13.8 | 1.4710145 | 4.7753625 |
| Ventriculus | 27.9 | 25 | 47 | 0.593617 | 0.5319149 |
| Thoracic muscle | |||||
| Fat body | 34.1 | 42 | 23.9 | 1.4267782 | 1.7573222 |
| Malpighian tubules | 25.4 | 45.3 | 29.4 | 0.8639456 | 1.5408163 |
| Nerve chord | 31.6 | 38 | 30.5 | 1.0360656 | 1.2459016 |
| Poison sac | |||||
| Sting | 58.5 | 41.5 | 1.4096385 | ||
| Heart | 22.6 | 49.6 | 27.7 | 0.8158845 | 1.7906138 |
| Hypopharyngeal gland | 9.8 | 90.2 | 0.10864745 | ||
| Galea | 31.4 | 35 | 33.6 | 0.9345238 | 1.0416666 |
| Glossa | 15.5 | 47 | 37.5 | 0.41333333 | 1.2533333 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.5 | 38.4 | 35.1 | 0.8689459 | 1.0940171 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASELPPTLKQLFNYIDDHKTEYINNLREVVAIKSVSAWPNHRNEVIKMMKWTEIKLKNL GINTELVDIGKQVLPDGNQIPLPPVLLGTYGSDSKKKTVLIYGHLDVQPALKEDGWDSEP FILTEKNGKLFGRGSTDDKGPVLCWIHVLQAYKAIGIDIPVNLKFVFEGMEESGSEGLDE LLWARKNTFLQNVDYICISDNYWLTTKKPCITYGLRGICYFHVEVICADKDMHSGTYGGI LHEAMPDLIYLLNTLVDVNGKILIDDIYGKVDKILEKELESYKTIEFDIAEFRDSTGINK LVHNEDKIQILMHRWREPSLSLHGIEGAFSEPGAKTVIPRKVIGKFSIRIVPSMTPEDTA KKVIAYLNKKWAARGSPNTFNVNMYHGGKTWSENPDHPNYLAGRKAIKHVYNVEPDLSRE GGSIPVTLTFQETTGKNIILLPIGASDDGAHSQNEKINIYNYIEGTKMLGAYLYEIAQLQ Q |
 Top
| |