| Protein: 66530338 XP_396126.2 PREDICTED: probable phosphoserine aminotransferase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.7 | 36.5 | 24.8 | 1.5604838 | 1.4717742 |
| Scape | 37.5 | 33.6 | 28.9 | 1.2975779 | 1.1626297 |
| Brain | 78.9* | 21.1 | 3.7393365 | ||
| Crop | 33.8 | 66.2 | 0.51057404 | ||
| Eye | |||||
| Intestine | 23.8 | 35.3 | 40.9 | 0.5819071 | 0.8630807 |
| Leg, front | 64.8 | 35.2 | 1.8409091 | ||
| Leg, middle | |||||
| Leg, rear | 67.7 | 14.4 | 17.9 | 3.7821229 | 0.8044693 |
| Mandibular gland | 11.2 | 70.4 | 18.4 | 0.6086956 | 3.826087 |
| Rectum | |||||
| Salivary gland, cerebral | 88.7 | 11.3 | 7.8495574 | ||
| Salivary gland, thoracic | 12.6 | 55.9 | 31.4 | 0.40127388 | 1.7802547 |
| Sternite | 11.3 | 24.9 | 63.8 | 0.17711599 | 0.39028212 |
| Tergite | 2.6 | 28.6 | 68.8 | 0.037790697 | 0.41569766 |
| Ventriculus | 86.9* | 13.1 | 6.633588 | ||
| Thoracic muscle | |||||
| Fat body | 10.8 | 8.4* | 80.7 | 0.133829 | 0.10408922 |
| Malpighian tubules | 20.8 | 50.1 | 29.1 | 0.71477664 | 1.7216495 |
| Nerve chord | 14.7 | 73.6* | 11.7 | 1.2564102 | 6.2905984 |
| Poison sac | |||||
| Sting | 35 | 65 | 0.53846157 | ||
| Heart | 5.3* | 23.4 | 71.3 | 0.0743338 | 0.32819074 |
| Hypopharyngeal gland | 52.3 | 47.7 | 1.096436 | ||
| Galea | 4.2* | 55.8 | 40 | 0.105 | 1.395 |
| Glossa | 38.1 | 61.9 | 0.6155089 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.4 | 46 | 40.4 | 0.65346533 | 1.1386138 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSNQSNISKNKVINFGAGPGKLPEQVLQHVQKELLAYNNTGISILELSHRSIDFKNIVEE AQIILREILHIPDNYKILFMQGGGTGIFAAIPLNMMTTGTADYLVTGTWSDKAAKEAVKY GKVNLVLPQSTKYTEIPDPSTWKLDPNASYVYYCANETIHGIEFNYIPETNGIPLVADMS SNILTRSFDVSKFALIFAGAQKNIGPAGVTLVIVREDVLGQAMKICPIIFDFTIMANNNS IYNTPPVFQIYVVGLVFKWVKENGSVEGMEKLAIAKSQKIYDVINKSKNFYSCPVKSDVR SRMNVPFRIGKNDEKLENEFLSGASERGMLQLKGHRLVGGIRASLYNAVTIEEVEILAEY MMWFYQKYGKN |
 Top
| |