| Protein: 66512838 XP_393341.2 PREDICTED: amphiphysin |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.9 | 34.8 | 38.3 | 0.70234984 | 0.9086162 |
| Scape | 41.6 | 25.4 | 33 | 1.260606 | 0.76969695 |
| Brain | |||||
| Crop | 34.9 | 25 | 40.1 | 0.8703242 | 0.6234414 |
| Eye | |||||
| Intestine | 51.4* | 29.7 | 18.9 | 2.7195768 | 1.5714285 |
| Leg, front | 41.4 | 27.4 | 31.2 | 1.3269231 | 0.8782051 |
| Leg, middle | 42 | 24.4 | 33.7 | 1.2462908 | 0.7240356 |
| Leg, rear | 20.5 | 41.6 | 37.8 | 0.54232806 | 1.1005291 |
| Mandibular gland | 40.4 | 59.6 | 0.67785233 | ||
| Rectum | |||||
| Salivary gland, cerebral | 13.4 | 35.6 | 51 | 0.2627451 | 0.69803923 |
| Salivary gland, thoracic | 51.3 | 18.2 | 30.4 | 1.6875 | 0.5986842 |
| Sternite | 38.2 | 30.8 | 31 | 1.2322581 | 0.9935484 |
| Tergite | 77.5 | 22.5 | 3.4444444 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 87.5* | 9.3 | 3.2 | 27.34375 | 2.90625 |
| Malpighian tubules | 61.9 | 10 | 28.1 | 2.202847 | 0.3558719 |
| Nerve chord | 55 | 17.3 | 27.7 | 1.9855596 | 0.62454873 |
| Poison sac | |||||
| Sting | 23.1 | 76.9 | 0.30039012 | ||
| Heart | 54 | 15.2 | 30.8 | 1.7532468 | 0.4935065 |
| Hypopharyngeal gland | 82.1 | 17.9 | 4.586592 | ||
| Galea | 23.6 | 32.4 | 44 | 0.53636366 | 0.73636365 |
| Glossa | 14.3 | 28.9 | 56.9 | 0.2513181 | 0.5079086 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.1 | 28.4 | 35.6 | 1.2106742 | 0.7977528 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAESKGALIAKTVQKHAGRAKEKFLQNLGKVDRTADDIFDEHLQNFMRQQNAANRLQKEF NNYIRCVRAVQAASKTLMDSLNEIYESQWTGHDLLYVQAQNLDMLWQDFTHKLADQVLVP LNTYQSQFPEMRKKIDKRGRKLVDYDSQRHNFQSLQCNPRKRDELKVSRGKELLEEAKRT YEQLNSELHDELPALYDSRVLFLVTNLQTLFAAEQVFHTESAKVYSELEAIVDKLANESQ RGSYTLKKNTEPQSPKSPNANSALIINTQPAQNNISPAVDDSAPAARNTSPTTQLNGNAN SNANSNDNSLNNQDASPQNTVTASKRVEELYDIPVDVDELSFDVGDIIRVVEYDDPEEQE QGWLMGIKEGTNEKGMFPANFTKPL |
 Top
| |